Search by BoMiProt ID - Bomi8438


Primary Information

BoMiProt ID Bomi8438
Protein Name Protein transport protein Sec23A/SEC23-related protein A
Organism Bos taurus
Uniprot IdA2VDL8
Milk FractionWhey
Ref Sequence Id NP_001075073.1
Aminoacid Length 768
Molecular Weight 86674
Fasta Sequence https://www.uniprot.org/uniprot/A2VDL8.fasta
Gene Name SEC23A
Gene Id 533994
Protein Existence Status Reviewed

Secondary Information

Protein Function involved in intracellular protein transport and autophagy.Sec23 is a component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER) to golgi.
PTMs phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VDL8|SC23A_BOVIN Protein transport protein Sec23A OS=Bos taurus OX=9913 GN=SEC23A PE=2 SV=1 MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVL CSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISELNQPAELLPQFSSIEYV VLRGPQMPLIFLYVVDTCMEDEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGC EGISKSYVFRGTKDLSAKQLQEMLGLSKVPVTQATRGPQVQQPPPSNRFLQPVQKIDMNL TDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM VVGDELKT*308PIRSWHDIEKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEM KCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMHGQFKMGFGGTLEIKTSREIKISGAI GPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPTTTLAIYFEVVNQHNAPIPQGGRGAIQ FVTQYQHSSGQRRIRVTTIARNWADAQTQIQNIAASFDQEAAAILMARLAIYRAETEEGP DVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLYPQFMFHLRRSPFLQVFNNSPDES SYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEPVLLDSSSILADRILLMDTFFQILIYH GETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLS KVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKTCCVKCCLMC
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs  serine 207, serine 312 and threonine 405 on Sec23A are phosphorylated by ULK1.ULK1 phosphorylates Sec23A at residues serine 207 and threonine 405 and thereby, reduces traffic at ERES.Serine207 of Sec23A is important for Sec31A binding.Phosphorylation at Tyr-737 by SRC occurs at the plasma membrane in clathrin-coated vesicles (CCVs)
Bibliography Gan W, Zhang C, Siu KY, Satoh A, Tanner JA, Yu S. ULK1 phosphorylates Sec23A and mediates autophagy-induced inhibition of ER-to-Golgi traffic. BMC Cell Biol. 2017 May 10;18(1):22. doi: 10.1186/s12860-017-0138-8. PMID: 28486929; PMCID: PMC5424413.