Search by BoMiProt ID - Bomi8437


Primary Information

BoMiProt ID Bomi8437
Protein Name Protein transport protein Sec16B/Regucalcin gene promoter region-related protein p117/RGPR-p117/SEC16 homolog B
Organism Bos taurus
Uniprot IdQ75NY9
Milk FractionWhey
Ref Sequence Id NP_996854.2
Aminoacid Length 1052
Molecular Weight 117174
Fasta Sequence https://www.uniprot.org/uniprot/Q75NY9.fasta
Gene Name SEC16B
Gene Id 404548
Protein Existence Status reviewed

Secondary Information

Protein Function plays a key role in the formation of coat protein II vesicles, which mediate protein transport from the endoplasmic reticulum (ER) to the Golgi apparatus.
Biochemical Properties The C-terminal region of Sec16B is rich in Gly (12.6%) and Ser (13.5%), and it is not conserved in Sec16A. This unique amino acid composition of the C-terminal region may allow Sec16B to localize to special ER domains, where it modulates the export of Pex16 and Pex3 from the ER.Deletion of the C-terminal 348 amino acids of Sec16B abrogated the ability to rescue the Sec16B depletion phenotype, suggesting the importance of the C-terminal region in peroxisome biogenesis.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q75NY9|SC16B_BOVIN Protein transport protein Sec16B OS=Bos taurus OX=9913 GN=SEC16B PE=2 SV=1 MEPWIPQWLPQPSGRPPAPSKDPDRGLWKDRYYQPIPHSWHNGERVHQRQDVGRS*55PQPQQ DPREDLQEPHYAARS*75GEWRPPVSGVDYYEGGYPSQLYSRWSIEDLYQSYYSPALREEYAY GSYYYHGHPQQLQEERVPRQGS*142PYIWQEDHRDQKYLNDHQHENQNS*166PFGTNRETQLQSKS RNPYKDS*187PAS*190NSGQERPEDLFMESPLTGAQKNKLSLMEESNLLWQHESGLTSSSYELSQY MADASELCDPMTS*253AVWS*257PVQAEDISAAGPKEPMKFYVPHMPVSFGPGGQLVCVSPSSPSD GQTALVELHSMEVILNDSEEQEEMRTFSGPLIREDVHKVDIMTFCQQKAAQSHKSETPGS RDSALLWQLLVLLCRQNGSMVGSDIAELLMQDWKKLEKYKRQPPVANLINLTDEDWPVLS SGTRDLLTGEILPSVETPAQILEKFTKLLYYGRKKEALEWAMKNHLWGHALFLASKMDPR THSRVMSGFTSTLALNDPLQTLFQLMSGRIPQAATCCGDKQWGDWRPHLAVILSNQGGDP ELYQRTIVAMGDTLAGKGLVEAAHFCYLMAHVPFGYYTVKTDYLALLGSSHSQEFLKSAT TEAIQRTEIFEYCQMLGRPKSFIPSFQVYKLLYASRLADYGLTSQALHYCEPVGTALLSH GESSHPVLLVELIKLAERLKLSDPLVLERRRHRGDRDLEPDWCVHLRGHHRELQQKEAGD IGRPQSAQAVISEARKTPENTFYQDLSGPQGNSEAYGDRSALWPTLEQSGPAQLSPQQPR SYPTGGGSGQMGVPVPLYSVPETHLLGTSGSMAVTGAPGGTAWEEAQQIHLPPVSPETLQ HPDGQKAISRPQVPLIPRARSIS*863ESS*866IVS*869VKEDEEEPPRRQIKIFLKYRPERKPEREGDT KSSGFGWFSWFRSKPTHNASPSGEEDSSDSPDSEEMPRAASLPQPSPSLSLTPSPDPQSL LGASAFSRDTGGDEVRGSVSGVGTAEGPGSGGLSGPEGVSTELCLNAGVLLPPPSVKGSV PLYNPSQVPQLSTVTSLNRPNRLAQRRYPTQS
Predicted Disorder Regions 188-235, 718-867, 887-1030
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs In Drosophila, Sec16 is shown to be phosphorylated in the C-terminal region in response to nutrient starvation.N-terminal 565 residues includes the 30 phosphorylation sites.Sec16 phosphorylation is dispensable for its function in ER export.Two distinct phosphorylation sites, Thr-415 and Ser-846, were identified in the N-terminal region of mammalian Sec16 homologue Sec16A.
Additional Comments Sec16 was first characterized in yeast S. cerevisiae as a 240-kDa peripheral membrane protein that interacts with coat protein II (COPII) coat components and facilitates their assembly and vesicle budding
Bibliography 1.Yonekawa S, Furuno A, Baba T, Fujiki Y, Ogasawara Y, Yamamoto A, Tagaya M, Tani K. Sec16B is involved in the endoplasmic reticulum export of the peroxisomal membrane biogenesis factor peroxin 16 (Pex16) in mammalian cells. Proc Natl Acad Sci U S A. 2011 Aug 2;108(31):12746-51. doi: 10.1073/pnas.1103283108. Epub 2011 Jul 18. PMID: 21768384; PMCID: PMC3150892. 2.Yorimitsu T, Sato K. Sec16 function in ER export and autophagy is independent of its phosphorylation in Saccharomyces cerevisiae. Mol Biol Cell. 2020 Feb 1;31(3):149-156. doi: 10.1091/mbc.E19-08-0477. Epub 2019 Dec 18. PMID: 31851588; PMCID: PMC7001475.