Search by BoMiProt ID - Bomi8432


Primary Information

BoMiProt ID Bomi8432
Protein Name Protein THEMIS/Thymocyte-expressed molecule involved in selection
Organism Bos taurus
Uniprot IdA5D789
Milk FractionWhey
Ref Sequence Id NP_001091585.1
Aminoacid Length 641
Molecular Weight 73132
Fasta Sequence https://www.uniprot.org/uniprot/A5D789.fasta
Gene Name THEMIS
Gene Id 540554
Protein Existence Status reviewed

Secondary Information

Protein Function Plays a critical requirement for THEMIS during thymocyte positive selection, implicating THEMIS in signaling downstream of the T cell antigen receptor (TCR)
Biochemical Properties THEMIS, a recently identified T-lineage-restricted protein, is the founding member of a large metazoan protein family. 
PTMs Phosphorylation at Ser
Significance of PTMs Phosphorylated on Tyr residues quickly after TCR stimulation
Additional Comments THEMIS is constitutively bound to the tyrosine phosphatases SHP1 or SHP2, provides a mechanism for THEMIS action.
Linking IDs Bomi8432
Bibliography 1.Choi S, Cornall R, Lesourne R, Love PE. THEMIS: Two Models, Different Thresholds. Trends Immunol. 2017 Sep;38(9):622-632. doi: 10.1016/j.it.2017.06.006. Epub 2017 Jul 8. PMID: 28697966; PMCID: PMC5788012. 2.Gascoigne NR, Acuto O. THEMIS: a critical TCR signal regulator for ligand discrimination. Curr Opin Immunol. 2015 Apr;33:86-92. doi: 10.1016/j.coi.2015.01.020. Epub 2015 Feb 18. PMID: 25700024.
Protein Function Plays a critical requirement for THEMIS during thymocyte positive selection, implicating THEMIS in signaling downstream of the T cell antigen receptor (TCR)
Biochemical Properties THEMIS, a recently identified T-lineage-restricted protein, is the founding member of a large metazoan protein family. 
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5D789|THMS1_BOVIN Protein THEMIS OS=Bos taurus OX=9913 GN=THEMIS PE=2 SV=1 MALSLEEFIHSLDLRTLPRVLEIQSGFYFEGSIYEMFGNECCLSTGEVIKITDLKIKKIM AEICEHVEGCVSPQSFELPMNFPGLFKIVADTTPYLTMEEITKANHIRPSRPNHPCFYHQ KDIKLENLIIKKGERIMLNSVEEINGEIMVNCSVLRNHQNHSFTLPLSQEGEFYECEDEH IYTLKEIIQWKIPKNRTRTVILTGFSAKWDSTNPFPRGFYGAVILKPVYEIQAVMKFRKD IVRILPSLDVEVKDITDSYDANWFLQVLSTQDLYEMANKQFPIVAEVIEAPQGNQLPISI LQPGKTIVIHKKCQASKILASEIRSNSSKRHFLIPTSYKGKFKRRPREFPTAYDLEIAKS EKEPLHVVATKAFHSPFEELSSVSVGDEFLVHHSQTTEVLCEGIKKVMDGLACEKILKNS REVALLPLYMDGGFVEVIHDKKLYQISELCAQFRLPFNVKVSVRDLFIEKDILAAIPGLQ LEESITNSYLLISDLANPKKCWEIPVGRVNMTVQLVNNFSGDTGSFLVSTLVEEITEEQY YLIRRYEKSFLHPPPRPPKHPSVEKIELTPLSLAKQKTVNLPKS*584PKSVHVDRSKKLYSNQ AGLDSKVPAGCQNDLADLEKEKRKTEATAVTEIFKTEEHKK
Predicted Disorder Regions 576-641
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated on Tyr residues quickly after TCR stimulation
Additional Comments THEMIS is constitutively bound to the tyrosine phosphatases SHP1 or SHP2, provides a mechanism for THEMIS action.
Linking IDs
Bibliography 1.Choi S, Cornall R, Lesourne R, Love PE. THEMIS: Two Models, Different Thresholds. Trends Immunol. 2017 Sep;38(9):622-632. doi: 10.1016/j.it.2017.06.006. Epub 2017 Jul 8. PMID: 28697966; PMCID: PMC5788012. 2.Gascoigne NR, Acuto O. THEMIS: a critical TCR signal regulator for ligand discrimination. Curr Opin Immunol. 2015 Apr;33:86-92. doi: 10.1016/j.coi.2015.01.020. Epub 2015 Feb 18. PMID: 25700024.