Search by BoMiProt ID - Bomi8421


Primary Information

BoMiProt ID Bomi8421
Protein Name Protein SGT1 homolog/Suppressor of G2 allele of SKP1 homolog
Organism Bos taurus
Uniprot IdQ2KIK0
Milk FractionExosomes
Ref Sequence Id NP_001039668.1
Aminoacid Length 338
Molecular Weight 38074
Fasta Sequence https://www.uniprot.org/uniprot/Q2KIK0.fasta
Gene Name SUGT1
Gene Id 515509
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells tongue muscle
Protein Function Animal SGT1 is a component of Skp1-Cullin-F-box protein (SCF) ubiquitin ligases that target regulatory proteins for degradation.
PTMs N-Acetylation at Ala, Isopeptide bond formation, Phosphorylation at Ser, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KIK0|SGT1_BOVIN Protein SGT1 homolog OS=Bos taurus OX=9913 GN=SUGT1 PE=2 SV=1 MAAAAAGPVAAASRLFRSFSDALIEQDPQAALEELTKALEQKPDDAPYYCQRAYCHILLG NYSDAVADAKKSLELNPNSSTALLRKGICEYHEKNYAAALETFTEGQKLNSADADLTAWI KRCQEAQNGSQPEVSASQRTHQSKIKYDWYQTESQVIITLMIKNVQKNDVNVEFSEKELS ALVKLPSGDDYSLKLRLLHPIIPEQSTFKVLSTKIEIKMKKPEAVRWEKLEGQGDVPNPK PFIADVKNLYPSSS*254HYT*257RNWDKLVGEIKEEEKNEKLEGDAALNKLFQQIYSDGSDEVKRA MNKS*304FMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Predicted Disorder Regions 5-7, 128-143, 234-238, 251-259, 271-281, 289-306, 321-338
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated at Ser-254,304 and dephosphorylation promotes nuclear translocation, most likely due to disruption of the SUGT1-HSP90 complex.
Bibliography 1.Austin MJ, Muskett P, Kahn K, Feys BJ, Jones JD, Parker JE. Regulatory role of SGT1 in early R gene-mediated plant defenses. Science. 2002 Mar 15;295(5562):2077-80. doi: 10.1126/science.1067747. Epub 2002 Feb 14. PMID: 11847308. 2.