Primary Information |
|---|
| BoMiProt ID | Bomi8421 |
|---|
| Protein Name | Protein SGT1 homolog/Suppressor of G2 allele of SKP1 homolog |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2KIK0 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001039668.1 |
|---|
| Aminoacid Length | 338 |
|---|
| Molecular Weight | 38074 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SUGT1 |
|---|
| Gene ID | 515509 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | tongue muscle |
|---|
| Protein Function | Animal SGT1 is a component of Skp1-Cullin-F-box protein (SCF) ubiquitin ligases that target regulatory proteins for degradation. |
|---|
| PTMs | N-Acetylation at Ala, Isopeptide bond formation, Phosphorylation at Ser, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2KIK0|SGT1_BOVIN Protein SGT1 homolog OS=Bos taurus OX=9913 GN=SUGT1 PE=2 SV=1
MAAAAAGPVAAASRLFRSFSDALIEQDPQAALEELTKALEQKPDDAPYYCQRAYCHILLG
NYSDAVADAKKSLELNPNSSTALLRKGICEYHEKNYAAALETFTEGQKLNSADADLTAWI
KRCQEAQNGSQPEVSASQRTHQSKIKYDWYQTESQVIITLMIKNVQKNDVNVEFSEKELS
ALVKLPSGDDYSLKLRLLHPIIPEQSTFKVLSTKIEIKMKKPEAVRWEKLEGQGDVPNPK
PFIADVKNLYPSSS*254HYT*257RNWDKLVGEIKEEEKNEKLEGDAALNKLFQQIYSDGSDEVKRA
MNKS*304FMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
|
|---|
| Predicted Disorder Regions | 5-7, 128-143, 234-238, 251-259, 271-281, 289-306, 321-338 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylated at Ser-254,304 and dephosphorylation promotes nuclear translocation, most likely due to disruption of the SUGT1-HSP90 complex. |
|---|
| Bibliography | 1.Austin MJ, Muskett P, Kahn K, Feys BJ, Jones JD, Parker JE. Regulatory role of SGT1 in early R gene-mediated plant defenses. Science. 2002 Mar 15;295(5562):2077-80. doi: 10.1126/science.1067747. Epub 2002 Feb 14. PMID: 11847308. 2. |
|---|
