Search by BoMiProt ID - Bomi8407


Primary Information

BoMiProt ID Bomi8407
Protein Name Protein PROCA1
Organism Bos taurus
Uniprot IdA7E371
Milk Fractionwhey
Ref Sequence Id NP_001160040.1
Aminoacid Length 376
Molecular Weight 42242
Fasta Sequence https://www.uniprot.org/uniprot/A7E371.fasta
Gene Name PROCA1
Gene Id 510175
Protein Existence Status Reviewed

Secondary Information

Protein Function It displays phospholipase A2 activity
Biochemical Properties It interacts with cyclin A1.The deduced protein has an N-terminal proline-rich region and was predicted to localize to the nucleus. It also has 2 possible phosphorylation sites. Real-time RT-PCR of 16 human tissues detected high PROCA1 expression in testis, with little to no expression in other tissues.
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7E371|PRCA1_BOVIN Protein PROCA1 OS=Bos taurus OX=9913 GN=PROCA1 PE=2 SV=2 MWVRTTLRIERWTKEKTEDDTSSWDESSTDINRLPSWGRGHLLASVESSTDASTLSSEGE FKNTDRCCWKHKCAGHIVRPFSPDCVHHDVHLHSLSHCDCDSRLKDCSEKTNSSSGDVGP TCSRDVDSTCFDIIQSPCFELIPEEECVERFWYGWCKSYRPVSVAVIHHPIHHECGADDL NQEEEEEEEEESKPPIPTQVGPTPTDSPTDTGMSMITGAPDSAAPITIWRSESPTGKSQG NRVIKKIKKKKEKDKEEETDEKEKAKVKKKVKKGKLMKKKSPVKSESPPDLSRSLSPREL ARMSESSPDSRQDLESEDS*319YNDPGREEPS*329S*330EDIVESSSPRKREKNGVQVKKPGLKTSPVK KINKRRS*367PPASNPNLS*376
Predicted Disorder Regions 16-29, 45-57, 114-120, 174-376
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Diederichs, S., Baumer, N., Ji, P., Metzelder, S. K., Idos, G. E., Cauvet, T., Wang, W., Moller, M., Pierschalski, S., Gromoll, J., Schrader, M. G., Koeffler, H. P., Berdel, W. E., Serve, H., Muller-Tidow, C. Identification of interaction partners and substrates of the cyclin A1-CDK2 complex. J. Biol. Chem. 279: 33727-33741, 2004. 2.Bovine Genome Sequencing and Analysis Consortium, Elsik, C. G., Tellam, R. L., Worley, K. C., Gibbs, R. A., Muzny, D. M., Weinstock, G. M., Adelson, D. L., Eichler, E. E., Elnitski, L., Guigó, R., Hamernik, D. L., Kappes, S. M., Lewin, H. A., Lynn, D. J., Nicholas, F. W., Reymond, A., Rijnkels, M., Skow, L. C., Zdobnov, E. M., … Zhao, F. Q. (2009). The genome sequence of taurine cattle: a window to ruminant biology and evolution. Science (New York, N.Y.), 324(5926), 522–528. https://doi.org/10.1126/science.1169588