Search by BoMiProt ID - Bomi8403


Primary Information

BoMiProt ID Bomi8403
Protein Name Protein PHTF1
Organism Bos taurus
Uniprot IdQ08DA4
Milk FractionWhey
Ref Sequence Id NP_001069545.1
Aminoacid Length 762
Molecular Weight 87159
Fasta Sequence https://www.uniprot.org/uniprot/Q08DA4.fasta
Gene Name PHTF1
Gene Id 536504
Protein Existence Status reviewed

Secondary Information

Protein Function Phtf1 provides a potential new marker for Golgi modifications as well as for many of the obscure transformations undergone by the endoplasmic reticulum. It could help to elucidate the morphogenic events connected with the transformation of spermatogenic cells.
Biochemical Properties The conservation between human (PHTF1) and mouse (phtf1) protein extends over the entire protein and is remarkably high (98% similarity). We reported previously the cloning of the Drosophila ortholog (d-phtf) that displays 56% similarity with phtf1 over its entire length. The highest identities between PHTF1 and d-phtf were localized at the NH2- and COOH-terminal regions and included a putative homeodomain region. However, 7–8 stretches of hydrophobic amino acid residues could indicate that phtf1 is a membrane-spanning protein.
PTMs N-Linked Glycosylation at Asn and Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DA4|PHTF1_BOVIN Protein PHTF1 OS=Bos taurus OX=9913 GN=PHTF1 PE=2 SV=1 MASNERDAISWYQKKIGAYDQQIWEKSIEQTQIKGFKNKPKKMGHIKADLIDVDLIRGST FAKAKPEIPWTSLTRKGLVRVVFFPLFSSWWIQVTSLRIFVWLLLLYLMQVIALVLYFMM PIVNVSEVLGPLCLMLLMGTVHCQIVSTQITRPSGNNGNRRRRKLRKTVNGDGSRENGN*179N*180 SSDKARGVETLESAPLN*197GSFWRTLFGNRMKRVKLICNRGTETDYDSGCLHPIIKKRQCRP EIRMWQTREKAKFSDGEKGRRESFRRLGNGIS*272DDLS*276S*277DDDGEAQTQMMILRRSVEGASSD NGCEIKSRKSILSRHLNTQVKKTTSKWCSVVRDS*334DS*336LAESEFESAAFSQGSRSGMSGGSR SLNMLRRDSESTRHDSETEDMLWDDLLHGPECRSSVTSDSEGAHVSSLHSGTKRDPKEDV FQQNHLFWLQN*431SSPASDRVSAIIWEGNECKKMDMSVLEISGIIMSRVNAYQQGVGYQMLG NIVTIGLAFFPFLHRLFREKNLDQLKSISAEEILTLFCGAPPVTPIIILSIINFFERLCL TWMFFFMMCVAERTYKQRFLFAKLFSHITSARKARKYEIPHFRLKKVENIKIWLSLRSFL KRRGPQRSVDVVVSSVFLLTLSIAFICCAQVLRGHKTFLNDAYNWEFLIWESALLLFLLR LASLGSETNKKYSN*674VSILLTEQINLYLKMEKKPNKKEQLTLVNNVLKLSTKLLKELDTPF RLYGLTMNPLIYN*733ITRVVILSAVSGVISDLLGFNIRLWKIKS
Predicted Disorder Regions 153-188, 248-283, 299-316, 340-378, 400-413
DisProt Annotation
TM Helix Prediction 7TMHs; (100-122),(128-150),(472-494),(513-535),(611-633),(648-666),(737-755)
Additional Comments Phtf1 possesses an evolutionarily-conserved structure and also displays a conserved pattern of expression even in Drosophila (data not shown), which strongly suggests that this protein may play an important role in the differentiation of germinal cells.
Bibliography 1.Oyhenart J, Le Goffic R, Samson M, Jégou B, Raich N. Phtf1 is an integral membrane protein localized in an endoplasmic reticulum domain in maturing male germ cells. Biol Reprod. 2003 Mar;68(3):1044-53. doi: 10.1095/biolreprod.102.009787. PMID: 12604659. 2.Manuel A, Beaupain D, Romeo PH, Raich N. Molecular characterization of a novel gene family (PHTF) conserved from Drosophila to mammals. Genomics 2000; 64:216–220.