Search by BoMiProt ID - Bomi8398


Primary Information

BoMiProt ID Bomi8398
Protein Name Protein phosphatase inhibitor 2/ IPP-2
Organism Bos taurus
Uniprot IdQ3SZX2
Milk FractionWhey,exosome
Ref Sequence Id NP_001030469.1
Aminoacid Length 207
Molecular Weight 22982
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZX2.fasta
Gene Name PPP1R2
Gene Id 532726
Protein Existence Status Reviewed

Secondary Information

Protein Function It acts as an inhibitor of protein-phosphatase 1.PPP1R2 recruited PP1 to the midbody and interference with its targeting resulted in elongated and severely disrupted central spindles supporting an important role for PPP1R2 in cytokinesis.PPP1R2 is a bifunctional protein – in addition to inhibiting PP1, PPP1R2 also regulates the G2/M transition by binding and activating AURKA.
Biochemical Properties C-terminus of PPP1R2 regulates the activity of AURKA and PP1.PP1 and AURKA bind to separate domains on the PPP1R2 protein; PP1 binds to the N-terminal region (aa 1–118), while AURKA binds to the C-terminal region (aa 119–197).
PTMs Acetylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZX2|IPP2_BOVIN Protein phosphatase inhibitor 2 OS=Bos taurus OX=9913 GN=PPP1R2 PE=2 SV=1 MAASTASHRPIKGILKNKSSTTSSVVSTAEQPGKSVDEELSKKS*44QKWDEMSILATYHPAD KDYGLMKIDEPST*73PYHSMVADDEDALS*87DS*89ETT*92EALT*96PDILARKLTAAAAESLEPKYRVRE QES*123S*124GDEDS*129DLS*132PEEREKKRQFEMKRKLHYNEGLNIKLARQLISKDLNDEEEDEEMSETAAGESMNMEESSQGSATSDQLQNKSQSS
Predicted Disorder Regions (1-207)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation on Ser-44 by ATM activates PP1 by dissociating the PP1-PPP1R2 complex. Glycogen synthase kinase-3β is known to inactivate PPP1R2 by phosphorylating threonine 72, thereby activating PP1.
Bibliography 1.Bresch AM, Yerich N, Wang R, Sperry AO. The PP1 regulator PPP1R2 coordinately regulates AURKA and PP1 to control centrosome phosphorylation and maintain central spindle architecture. BMC Mol Cell Biol. 2020 Nov 25;21(1):84. doi: 10.1186/s12860-020-00327-5. PMID: 33238888; PMCID: PMC7687763. 2.Korrodi-Gregório, L., Ferreira, M., Vintém, A. P., Wu, W., Muller, T., Marcus, K., Vijayaraghavan, S., Brautigan, D. L., da Cruz E Silva, O. A., Fardilha, M., & da Cruz E Silva, E. F. (2013). Identification and characterization of two distinct PPP1R2 isoforms in human spermatozoa. BMC cell biology, 14, 15. https://doi.org/10.1186/1471-2121-14-15