Search by BoMiProt ID - Bomi8385


Primary Information

BoMiProt ID Bomi8385
Protein Name Protein phosphatase 1 regulatory subunit 37/Leucine-rich repeat-containing protein 68
Organism Bos taurus
Uniprot IdA7Z026
Milk FractionWhey,MFGM
Ref Sequence Id NP_001098849.1
Aminoacid Length 699
Molecular Weight 75697
Fasta Sequence https://www.uniprot.org/uniprot/A7Z026.fasta
Gene Name PPP1R37/LRRC68
Gene Id 516932
Protein Existence Status reviewed

Secondary Information

Protein Function Inhibits phosphatase activity of protein phosphatase 1 (PP1) complexes.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7Z026|PPR37_BOVIN Protein phosphatase 1 regulatory subunit 37 OS=Bos taurus OX=9913 GN=PPP1R37 PE=2 SV=1 MEIPPQEAPPGPGADGEAEEAPVEAPSPGPASPPADGRLKAAAKRVTFPS*50DEDIVS*56GAVE PKDPWRHAQNVTVDEIIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRIDCLDLKGEKLD YKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGW QAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLESSSLSGRPLMLLA TALKMNMTLRELYLADNKLNGLQDSAQLGNLLKFNCSLQILDLRNNHVLDSGLAYICEGL KEQRKGLATLVLWNNQLTHTGMAFLGMTLPHTHSLETLNLGHNPIGNEGVRNLKNGLISN RSVLRLGLASTKLTCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNHSLL RLDLDREPKKEAVKSFIETQKALLAEIQNGCKRNFVLVREREEKEQRLQLSASMPEITVT EPQPDDEPREEPAAEAQENGAPGPSPGPDSDSDSDSEGEDRDEADGERAEAPCPTLVPPT DSLGPGDRSPPGCPSSPAEQRISVSS*566PGWGHKVFVVTRVESPPERAEPPVPPAPPGPVSP PASASPPTSPFPTPTEAASTPDPGPPEPQPPLEPPQVGPPLPNGLKPEFALALSPEPPPG PEAKVGSCGLEHELSCSKNEKELEELLLEASQESGQETL
Predicted Disorder Regions (1-35), (468-699)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Yang-Chun, F., Sen-Yu, W., Yuan, Z., & Yan-Chun, H. (2020). Genome-Wide Profiling of Human Papillomavirus DNA Integration into Human Genome and Its Influence on PD-L1 Expression in Chinese Uygur Cervical Cancer Women. Journal of immunology research, 2020, 6284960. https://doi.org/10.1155/2020/6284960