Search by BoMiProt ID - Bomi8378


Primary Information

BoMiProt ID Bomi8378
Protein Name Protein pelota homolog
Organism Bos taurus
Uniprot IdQ58DV0
Milk FractionExosomes,MFGM
Ref Sequence Id NP_001029738.1
Aminoacid Length 385
Molecular Weight 43421
Fasta Sequence https://www.uniprot.org/uniprot/Q58DV0.fasta
Gene Name PELO
Gene Id 528728
Protein Existence Status Reviewed

Secondary Information

Protein Function Cotranslational quality control factor involved in the No-Go Decay (NGD) pathway. In the presence of ABCE1 and HBS1L, is required for 48S complex formation from 80S ribosomes and dissociation of vacant 80S ribosomes. 
PTMs Isopeptide bond formation, Phosphorylation at Serine, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58DV0|PELO_BOVIN Protein pelota homolog OS=Bos taurus OX=9913 GN=PELO PE=2 SV=2 MKLVRKDIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNR VRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSV VLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDR ALERFYEQVVQAIQRHIHFDVVKCVLVASPGFVREQFCDYMFQQAVKTDNKVLLENRSKF LQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVE KANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLT GIAAILRFPVPELS*374DQENDS*380S*381S*382EED
Predicted Disorder Regions 374-385
DisProt Annotation
TM Helix Prediction No TM helices