Search by BoMiProt ID - Bomi8372


Primary Information

BoMiProt ID Bomi8372
Protein Name Protein NEDD1/Neural precursor cell expressed developmentally down-regulated protein 1
Organism Bos taurus
Uniprot IdQ3B7M6
Milk FractionWhey
Ref Sequence Id NP_001030410.1
Aminoacid Length 659
Molecular Weight 71204
Fasta Sequence https://www.uniprot.org/uniprot/Q3B7M6.fasta
Gene Name NEDD1
Gene Id 519463
Protein Existence Status reviewed

Secondary Information

Protein Function Promotes the nucleation of microtubules from the spindle and spindle assembly.Interacts with γ-TuRC, a γ-tubulin complex.
Biochemical Properties contains γ-tubulin-binding domain.
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3B7M6|NEDD1_BOVIN Protein NEDD1 OS=Bos taurus OX=9913 GN=NEDD1 PE=2 SV=1 MQENLRFASSGDDVKIWDASSMTLVDKFNPHTAPHAISSVCWSSNNNFLVTASSSGDKIV VSSCKCKPVPLLELGEGQKQTCVSLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKD EVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSIRHLKYSLFKKSLLGS VSDNGIVTLWDVNSQSPYHNFDSTHKAPASGICFSPVNELLFVTVGLDKRIILYDTSSKK LVKTLVADAPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPIKTISAHKTSVQCIAFQ YSTVLSKSGLNKGCSNKPTAVNKRTANVSAGGGGAQNPGVVREAATTSIATVPPQPTAAA VGKGAVAPQDKAGLPRSINTDT*382LSKEAESGKNQDFSNFDDSGKSSLGDMFS*411PVRDDAVVS KGGDES*426IGKGDGLDFLPQLNSVFPPRKNPVVSSTSVLHSSPLNVFMGS*468PGKEENENHDLT AESKKMYLGKQESKDSFKQFAKLISGAETGNLNAS*515PSSNQTRSPEKFEKPEKEIEAQLIN EPPGNGSST*549PNPKIASSVTAGVAGSLSEKIVDTIGNSRPNAPLSSVQIRFIQNMIQETLD DFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYS*636VNEGLVAEIERLREENKRLRAHF
Predicted Disorder Regions 343-410, 423-448, 467-580
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs There are multiple novel phosphorylated sites in the serine (Ser)557-S574 region of NEDD1, close to its γ-tubulin-binding domain.Phosphorylation in the S557–T560 region has a negative effect on NEDD1 function.phosphorylation of the S565–S574 region may promote NEDD1 activity.During mitosis,phosphorylation on Thr-549 by CDK1 which furthur promotes phosphorylation by PLK1 on Thr-382, Ser-426 and Ser-636.
Bibliography Gomez-Ferreria MA, Bashkurov M, Helbig AO, Larsen B, Pawson T, Gingras AC, Pelletier L. Novel NEDD1 phosphorylation sites regulate γ-tubulin binding and mitotic spindle assembly. J Cell Sci. 2012 Aug 15;125(Pt 16):3745-51. doi: 10.1242/jcs.105130. Epub 2012 May 17. PMID: 22595525.