Search by BoMiProt ID - Bomi8365


Primary Information

BoMiProt ID Bomi8365
Protein Name Protein MAL2
Organism Bos taurus
Uniprot IdA2VE13
Milk FractionExosomes,MFGM
Ref Sequence Id NP_001075188.1
Aminoacid Length 176
Molecular Weight 19146
Fasta Sequence https://www.uniprot.org/uniprot/A2VE13.fasta
Gene Name MAL2
Gene Id 511940
Protein Existence Status reviewed

Secondary Information

Protein Function Member of the machinery of polarized transport. Required for the indirect transcytotic route at the step of the egress of the transcytosing cargo from perinuclear endosomes in order for it to travel to the apical surface via a raft-dependent pathway
PTMs N linked glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VE13|MAL2_BOVIN Protein MAL2 OS=Bos taurus OX=9913 GN=MAL2 PE=1 SV=1 MSAGGAPVPPPPNPAMSFPAPRVTLPAGPDILRTYSGAFVCLEIVFGGLVWILVASSNVP LPLLQGWVMFVSVTAFVCSLLFLGVFLSGVVTQINANWNFLDFAYHFTVFVFYFGAFLLE AATTSLHDLRCN*132RTMTVQPLLSDNQYNINVAATIFAFVTTACYGCSLGLALRRWRP
Predicted Disorder Regions (1-23)
DisProt Annotation
TM Helix Prediction 4TMHs; (31-53),(68-90),(97-119),(148-170)