Search by BoMiProt ID - Bomi8362


Primary Information

BoMiProt ID Bomi8362
Protein Name Protein LRATD1/LRAT domain-containing 1/Protein FAM84A
Organism Bos taurus
Uniprot IdQ3ZCA1
Milk FractionWhey
Ref Sequence Id NP_001029831.1
Aminoacid Length 297
Molecular Weight 33127
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZCA1.fasta
Gene Name LRATD1/FAM84A
Gene Id 539071
Protein Existence Status reviewed

Secondary Information

Protein Function FAM84A expression increased cell motility in NIH3T3 cells, and that phosphorylation of serine 38 of FAM84A was associated with morphology of cells. 
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZCA1|LRAT1_BOVIN Protein LRATD1 OS=Bos taurus OX=9913 GN=LRATD1 PE=2 SV=1 MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFS*38DEEEDLDERGQPDKFGVKAPPG CAPCPESPSRHHHHHHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTA LPALCEPGDLLELLWLQPAPEPPAPAPHWAVYVGGGQIIHLCQGEIRQDSLYEAGAANVG RVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAG TQPPQQQYYLKVHLADNKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE
Predicted Disorder Regions 1-27, 39-76, 233-244
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Up-regulation of FAM84A plays a critical role in progression of colon cancer.
Bibliography Kobayashi T, Masaki T, Sugiyama M, Atomi Y, Furukawa Y, Nakamura Y. A gene encoding a family with sequence similarity 84, member A (FAM84A) enhanced migration of human colon cancer cells. Int J Oncol. 2006 Aug;29(2):341-7. PMID: 16820875.