Search by BoMiProt ID - Bomi8359


Primary Information

BoMiProt ID Bomi8359
Protein Name Protein lifeguard 2/Fas apoptotic inhibitory molecule 2
Organism Bos taurus
Uniprot IdQ1LZ71
Milk FractionWhey
Ref Sequence Id NP_001068886.1
Aminoacid Length 316
Molecular Weight 35184
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZ71.fasta
Gene Name FAIM2/LFG2
Gene Id 509790
Protein Existence Status reviewed

Secondary Information

Protein Function an antiapoptotic protein,Regulates Fas-mediated apoptosis in neuronal cells by interfering with Activating caspase 8,Plays a significant role in the development of cerebellum.
Biochemical Properties 1.DEAD-box proteins share a structurally similar core of two RecA-like domains (RecA_N and RecA_C) that contain the conserved motifs for ATP-dependent RNA unwinding. 2.Allosteric regulation of core activities by RNA-induced movement of ancillary domains may constitute a general regulatory mechanism of DEAD-box protein activity.
PTMs N-linked glycosylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZ71|LFG2_BOVIN Protein lifeguard 2 OS=Bos taurus OX=9913 GN=FAIM2 PE=2 SV=1 MTQGKLSVANKAPGTEGQQQANGEKKETPAVPSAPPSYEEATSGEGLKAGAFPPAPSAVP LHPSWAYVDPNSSSSYESGFPTGDHEFFTTFSWDDQKVRRVFIRKVYTILLIQLLVTLGV VALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMA YLTGMLSSYYN*191TTSVLLCLSITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLI LAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGSRRHSLSPEEYIFGALNIYLDI IYIFTFFLQLFGTNRE
Predicted Disorder Regions (1-88)
DisProt Annotation
TM Helix Prediction 7TMHs; (106-124),(139-157),(164-186),(192-214),(227-245),(249-271),(291-313)
Significance of PTMs  Activation of FAS death receptor via FAS-ligand led to JNK-mediated FAIM2 phosphorylation, decreased proteasome-mediated degradation and increased association with the FAS receptor
Additional Comments functions as a growth switch in juvenile zebrafish.
Bibliography 1.Pawar M, Busov B, Chandrasekhar A, Yao J, Zacks DN, Besirli CG. FAS apoptotic inhibitory molecule 2 is a stress-induced intrinsic neuroprotective factor in the retina. Cell Death Differ. 2017 Oct;24(10):1799-1810. doi: 10.1038/cdd.2017.109. Epub 2017 Jul 14. PMID: 28708137; PMCID: PMC5596422. 2.Bucan V, Reimers K, Choi CY, Eddy MT, Vogt PM. The anti-apoptotic protein lifeguard is expressed in breast cancer cells and tissues. Cell Mol Biol Lett. 2010 Jun;15(2):296-310. doi: 10.2478/s11658-010-0009-1. Epub 2010 Mar 19. PMID: 20336406; PMCID: PMC6275920. 3.1.Samatanga B, Andreou AZ, Klostermeier D. Allosteric regulation of helicase core activities of the DEAD-box helicase YxiN by RNA binding to its RNA recognition motif. Nucleic Acids Res. 2017 Feb