Search by BoMiProt ID - Bomi8358


Primary Information

BoMiProt ID Bomi8358
Protein Name Protein kintoun/Dynein assembly factor 2, axonemal
Organism Bos taurus
Uniprot IdQ0VC73
Milk FractionWhey
Ref Sequence Id NP_001069492.2
Aminoacid Length 829
Molecular Weight 90970
Fasta Sequence https://www.uniprot.org/uniprot/Q0VC73.fasta
Gene Name DNAAF2/KTU
Gene Id 534465
Protein Existence Status reviewed

Secondary Information

Protein Function Required for cytosolic pre-assembly of axonemal dyneins and play a central role in motility in cilia and flagella.
Biochemical Properties Its homologue in single-celled alga Chlamydomonas is known as PF13.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VC73|KTU_BOVIN Protein kintoun OS=Bos taurus OX=9913 GN=DNAAF2 PE=2 SV=2 MAKEAASSPLEDLDLSGEEVQRLTSAFQDPEFRRMFSEYAEELTDPENRRRYEEEITALE RERGVEVRFVHPEPGHVLRTSLDGTRRCFVNVCSNALVGAPSSQPGSGSAVSGRQWSLPY SLAPGREYAWGRGTRYTVYDVVFHPDAIALARRHERFRQMLDATALEAVEKQFGVKLDRR NAKTLKIKYKGTPDAAVLRTPLPGGAPARPEGEPESPFPDFPYPYRYPAAGASAAVPRPQ APSPPEAVRQPAPTEPRYSVVQRHHVDLQDYRCSRDSAPGTVPQELVVTIELPLLRSAEQ AALEVTGKLLCLDSRKPDYRLRLSLPYPVDDSRGKAQFNKARRQLVVTLPVAPTASRPEP AASPEEAADPPGTDGAACASACRGEAGPAGVCAGDAISGPSRTRAADAGITTPDAPGKER VAKSEERDFGGQEISTTGTREEPPSGAGNS*450PGDRGGGALSTSWGDLDAGLSVGSASVRPT LGVEARETREGTGREPAYRAMGGPGTDRGEALCPPLQCSQDEESLTLLVQVPWILLQSLQ GEVNPLWYKLSFSTQDLVYYSFFLQFTPENKLSTKEPEVSISSNNAVINLAKSPECHGYW REWYYGLNNYCLEERLFVNEDNVNEFLEEVLS*632PPFKQTLPLTPPLIEVLQVTDSKIEIHA KLQECSNSEQLHEKEERVHEGSPLTEKENTEHATISTTDSASSVAVTVLEADRCGSATCL QQGALDVSQKLFAESQQPKSEKEREFIKDKSAVYANERKDNLKEPVITEEKELDGNHPSS LLNKTAVRDTPGFDHIKETNMQDGSVQIIKDHVTHCSFSFQNNLLYDLD
Predicted Disorder Regions 1-11, 222-238, 256-274, 365-469, 490-504, 675-702, 718-758, 781-785
DisProt Annotation
TM Helix Prediction no TM helices
Additional Comments A mutation in Ktu/PF13 has been identified in some patients with primary ciliary dyskinesia (PCD).
Bibliography Ktu/PF13 is required for cytoplasmic pre-assembly of axonemal dyneins. Omran H, Kobayashi D, Olbrich H, Tsukahara T, Loges NT, Hagiwara H, Zhang Q, Leblond G, O'Toole E, Hara C, Mizuno H, Kawano H, Fliegauf M, Yagi T, Koshida S, Miyawaki A, Zentgraf H, Seithe H, Reinhardt R, Watanabe Y, Kamiya R, Mitchell DR, Takeda H. Nature 456, 611-6, (2008). View articlePMID: 19052621