Search by BoMiProt ID - Bomi8344


Primary Information

BoMiProt ID Bomi8344
Protein Name Protein jagunal homolog 1
Organism Bos taurus
Uniprot IdQ2NKY9
Milk FractionWhey
Ref Sequence Id NP_001039915.1
Aminoacid Length 183
Molecular Weight 21102
Fasta Sequence https://www.uniprot.org/uniprot/Q2NKY9.fasta
Gene Name JAGN1
Gene Id 539101
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  testis 
Protein Function Jagn1 deficiency results in alterations in the endoplasmic reticulum (ER) of antibody-producing cells as well as decreased antibody production and secretion. 
PTMs Phosphorylation at Ser,
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2NKY9|JAGN1_BOVIN Protein jagunal homolog 1 OS=Bos taurus OX=9913 GN=JAGN1 PE=2 SV=1 MAS*3RAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHL RLLSHDQVAMPYQWEYPYLLSVVPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSM EMFPAAQQLYRHGKAYRFLFGFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEK KRK
Predicted Disorder Regions 1-17, 179-183
DisProt Annotation
TM Helix Prediction 4TMHs; (40-62),(74-92),(99-117),(136-158)
Bibliography 1.Hagelkruys A, Wirnsberger G, Stadlmann J, Wöhner M, Horrer M, Vilagos B, Jonsson G, Kogler M, Tortola L, Novatchkova M, Bönelt P, Hoffmann D, Koglgruber R, Steffen U, Schett G, Busslinger M, Bergthaler A, Klein C, Penninger JM. A crucial role for Jagunal homolog 1 in humoral immunity and antibody glycosylation in mice and humans. J Exp Med. 2021 Jan 4;218(1):e20200559. doi: 10.1084/jem.20200559. PMID: 32930709; PMCID: PMC7953624. 2.