Search by BoMiProt ID - Bomi8325


Primary Information

BoMiProt ID Bomi8325
Protein Name Protein disulfide-isomerase A3/58 kDa glucose-regulated protein/58 kDa microsomal protein/p58/Disulfide isomerase ER-60/Endoplasmic reticulum resident protein 57/ER protein 57/Endoplasmic reticulum resident protein 60
Organism Bos taurus
Uniprot IdP38657
Milk FractionWhey,MFGM
Aminoacid Length 505
Molecular Weight 56930
Fasta Sequence https://www.uniprot.org/uniprot/P38657.fasta
Gene Name PDIA3/GRP58
Protein Existence Status reviewed

Secondary Information

Protein Function  for mediating the rapid cellular responses of vitamin D, in intestinal epithelia,involved in stimulation of calcium and phosphate intake.
Biochemical Properties has three catalytic activities including, thiol-disulfide oxireductase, disulfide isomerase and redox-dependent chaperon.has three catalytic activities including, thiol-disulfide oxireductase, disulfide isomerase and redox-dependent chaperon.The two redox active sites containing the CXXC motif are found in the a and a' domains.The two redox active sites containing the CXXC motif are found in the a and a' domains
PTMs phosphorylation,Acetylation,Methylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus OX=9913 GN=PDIA3 PE=2 SV=1 MRLRRLALFPGLALLLAAARLAAASDVLELTDDNFESRITDTGSSGLMLVEFFAPWCGHC KKLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEESGAYDGPRT ADGIVSHLKKQAGPASVPLKSEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRD NYRFAHTNVESLVNKYDDDGEGITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKRFIQENI FGICPHMTEDNKDLLQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGQKLHFA VASRKTFSHELSDFGLEST*319TGEIPVVAVRTAKGEKFVMQEEFSRDGKALERFLEDYFDGN LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG EKLRKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKQNPKKYEGGRELSDFISYL KREATNPPVIQEEKPKKKKKAQEDL
Predicted Disorder Regions 127-146, 484-505
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Yavuz U, Alaylıoğlu M, Şengül B, Karras SN, Gezen-Ak D, Dursun E. Protein disulfide isomerase A3 might be involved in the regulation of 24-dehydrocholesterol reductase via vitamin D equilibrium in primary cortical neurons. In Vitro Cell Dev Biol Anim. 2021 Aug;57(7):704-714. doi: 10.1007/s11626-021-00602-5. Epub 2021 Aug 2. PMID: 34338991.