Search by BoMiProt ID - Bomi8323


Primary Information

BoMiProt ID Bomi8323
Protein Name Protein chibby homolog 2/Spermatid-associated protein
Organism Bos taurus
Uniprot IdA6QQS3
Milk Fractionwhey
Ref Sequence Id NP_001095767.1
Aminoacid Length 455
Molecular Weight 52473
Fasta Sequence https://www.uniprot.org/uniprot/A6QQS3.fasta
Gene Name CBY2/SPERT
Gene Id 616053
Protein Existence Status Reviewed

Secondary Information

Protein Function CBY2 is a testis-specific leucine-zipper protein that interacts with NEK1 during late spermatid maturation.
Biochemical Properties contain an N-terminal leucine-zipper motif, 2 C-terminal coiled-coil regions, and several phosphorylation sites.
PTMs Phosphorylation
Additional Comments In situ hybridization, immunofluorescence analysis, and immunoelectron microscopy showed that Cby2 was expressed in inner cell layers within seminiferous tubules and formed large aggregates in flower-like structure organelles in cytoplasm.
Linking IDs Bomi8323
Bibliography Chen, S. Z., & Zheng, L. Z. (2021). SPERT gene silencing inhibits the growth of human colon cancer xenograft tumor in nude mice via p38MAPK/HSP27 signaling pathway. Biomedical research (Tokyo, Japan), 42(6), 247–255. https://doi.org/10.2220/biomedres.42.247
Protein Function CBY2 is a testis-specific leucine-zipper protein that interacts with NEK1 during late spermatid maturation.
Biochemical Properties contain an N-terminal leucine-zipper motif, 2 C-terminal coiled-coil regions, and several phosphorylation sites.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QQS3|CBY2_BOVIN Protein chibby homolog 2 OS=Bos taurus OX=9913 GN=CBY2 PE=2 SV=2 MSPLECSECFGDQLLHRTYTWHLTLHSRPNFTRKRDTRSES*41LEIPINVVLPQRGTAEPFL RLHNLYPTPRCARQAALPRLSRRVVS*86QHS*89YPLNRFSS*97VPLDPMERPTSQADLELDYNPPR VQLS*124DEMFVFQDGRWVSENCRLQS*144PYFS*148PS*150SSFHHKLHHKRLAKECLLQENKTLREENRALREENRMLRKENKILQVFWEEHQAALGRDDS*211RASSPLLHKDNASS*225LEAMKKETALQAHRGRENSTLQLLREENRALQQLLEQRKAYWAQPDEKAAS*276TEEIKPISSPHEEPHGLLPDPGPG LPSPFEEPKGLPAPPDDSKTLRALREMVSTLS*332AQPGEEVGKGGPGLPDGSQSLELLREMN QALQALREENQSLQVLRDENRLLQEENRALHALREEHRLFQEENKALWENNKLKLQQKLV IDTVTEVTARMEMLIEELYAFMPAKSKDPKKPSRV
Predicted Disorder Regions 95-118, 209-320, 330-409, 444-451
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments In situ hybridization, immunofluorescence analysis, and immunoelectron microscopy showed that Cby2 was expressed in inner cell layers within seminiferous tubules and formed large aggregates in flower-like structure organelles in cytoplasm.
Linking IDs
Bibliography Chen, S. Z., & Zheng, L. Z. (2021). SPERT gene silencing inhibits the growth of human colon cancer xenograft tumor in nude mice via p38MAPK/HSP27 signaling pathway. Biomedical research (Tokyo, Japan), 42(6), 247–255. https://doi.org/10.2220/biomedres.42.247