Search by BoMiProt ID - Bomi8322


Primary Information

BoMiProt ID Bomi8322
Protein Name Protein CASC3/Cancer susceptibility candidate gene 3 protein/Metastatic lymph node gene 51 protein homolog/Protein barentsz
Organism Bos taurus
Uniprot IdA5D7H5
Milk FractionWhey
Ref Sequence Id NP_001091538.1
Aminoacid Length 703
Molecular Weight 76147
Fasta Sequence https://www.uniprot.org/uniprot/A5D7H5.fasta
Gene Name CASC3/MLN51
Gene Id 531673
Protein Existence Status reviewed

Secondary Information

Protein Function It is a component of the spliceosome assambly and has a role in pre-mRNA splicing. 
PTMs Phosphorylation, ADP Ribosylation, Ubiquitinylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5D7H5|CASC3_BOVIN Protein CASC3 OS=Bos taurus OX=9913 GN=CASC3 PE=2 SV=1 MADRRRQRASQDTEDEESGASGSDSGGSPARGGGS*35CSGSVGGGGSGSLPSQRGGRAGALH LRRVESGGAKSAEESECESEDGIEGDAVLSDYESAEDSEGDDGEYSEEENSKVELKS*117EAN DAANSSAKDEKGEEKPDTKGTVTGERQS*148GDGQESTEPVENKVGKKGPKHLDDDEDRKNPA YIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALY GYDIRSAHNPDDIKPRRIRKPRFGS*265PPQRDPSWIGERPNKSHRHQGPGGTLPPRTFINRN AAGTGRMSAPRNYSRSGGFKEGRTGFRPAEAGGQHAGRSGETVKHETSYRSRHLEQT*357PVR DPS*363PEADAQVLGS*373PEKEEVAPEIPNPAPDTAPPVPDRPVEKKSYSRARRTRIKAGDAGKV AEEVPPPPEGLTPAPPVPEATPPTPAKTGNWEAPVDSTTGGLEQDVAQLNITEQNWS*477PGQ PAFLQSRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHI SIMEGHYYDPLQFQGPIYTHGDSPAPLPPQGMIVQPEMHLPHPGLHPHQTPAPLPNPGLY PPPVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQV YGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS
Predicted Disorder Regions (1-175), (252-277), (346-366)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs ADP-ribosylated by tankyrase TNKS and TNKS2. Poly-ADP-ribosylated protein is recognized by RNF146, followed by ubiquitination
Bibliography Cougot, N., Daguenet, E., Baguet, A., Cavalier, A., Thomas, D., Bellaud, P., Fautrel, A., Godey, F., Bertrand, E., Tomasetto, C., & Gillet, R. (2014). Overexpression of MLN51 triggers P-body disassembly and formation of a new type of RNA granules. Journal of cell science, 127(Pt 21), 4692–4701. https://doi.org/10.1242/jcs.154500