Search by BoMiProt ID - Bomi8321


Primary Information

BoMiProt ID Bomi8321
Protein Name protein canopy homolog 3
Organism Bos taurus
Uniprot IdQ0P5N1
Milk FractionWhey
Ref Sequence Id NP_001068907.1
Aminoacid Length 282
Molecular Weight 31388
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5N1.fasta
Gene Name CNPY3
Gene Id 510220
Protein Existence Status reviewed

Secondary Information

Protein Function Binds to toll-like receptor and functions as a chaperone to aid in folding and export of these proteins.
PTMs Glycosylation on Asn and Disulfide bond addition
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5N1|CNPY3_BOVIN Protein canopy homolog 3 OS=Bos taurus OX=9913 GN=CNPY3 PE=2 SV=1 MEPLPEPASGPRPRPHRLLLLSLLLLLLPLLPAPELGPRQARAEDTDWVRLPSKCEVCKY VAVELKSAFEETGKTKEVIDTGYGILDRKASGVKYTKSDLRLIEVTETICKRLLDYSLHK ERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWN*159ETSAEVADLKKQCDVLVEEFE EVIEDWYRNHQEEDLTQFLCANHVLKGKDASCLAEQWSGKKGDTAALGGKKSKKKSGRAK GLGGGSSKQRKELGDLDGDPSPEEDEGIQKASPLTHSPPDEL
Predicted Disorder Regions 3 disordered segments; (1-16), (36-47), (214-282)
DisProt Annotation
TM Helix Prediction No TM helices