Search by BoMiProt ID - Bomi8319


Primary Information

BoMiProt ID Bomi8319
Protein Name Protein argonaute-3/Argonaute3/Argonaute RISC catalytic component 3/Eukaryotic translation initiation factor 2C 3/eIF-2C 3/ eIF2C 3
Organism Bos taurus
Uniprot IdQ6T5B7
Milk FractionWhey
Aminoacid Length 861
Molecular Weight 97300
Fasta Sequence https://www.uniprot.org/uniprot/Q6T5B7.fasta
Gene Name AGO3/EIF2C3
Protein Existence Status reviewed

Secondary Information

Protein Function essential for piRNA amplification, have endonuclease activity.needed for proper germline development.
Biochemical Properties PAZ domain, the MID domain in the middle region, and the PIWI domain in the C terminus.PAZ and MID domains are proposed to bind to the 3′ and 5′ termini of a small RNA, respectively.PIWI domain possesses the conserved catalytic motif Asp-Asp-His (D-D-H: 643D, 713D, and 842H) which shows slicer activity.
PTMs Hydroxylation,Methylation,ubl conjugation,Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q6T5B7|AGO3_BOVIN Protein argonaute-3 OS=Bos taurus OX=9913 GN=AGO3 PE=2 SV=2 MEIGSAGPVGAQPLLMVPRRPGYGTMGKPTKLLANCFQVEIPKIDVYLYEVDIKPDKCPR RVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDATLPGEGGKDRP FKVSIKFVSRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGR SFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLD IHNIDEQPRPLTDSHRVKSTKEIKGLKVEVTHCGTMRRKYRVCNVTRRPASHQTFPLQLE NGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDN QTSTMIKATARSAPDRQEEISRLVRSANYETDPFVQEFQFKVRDEMAHVTGRVLPAPMLQ YGGRNRTVATPSHGVWDMRGKQFHTGVEIEMWAIACFATQRQCREEILKGFTDQLRKISK DAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTL LGMATQCVQVKNVIKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVT HPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQEIIQDLASMVRELLIQFYKSTRF KPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQPGITYIVVQKRHHTRLFCAD RTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADEL QLLTYQPSAHTYVHCTRSVSIPAPAYYAHLVAFRARYHLVDKERDS*826AEGSHVSGQSNGRD PQALAKAAQIHQDTLRTMYFA
Predicted Disorder Regions 824-842
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs prolyl 4-hydroxylation by type I collagen prolyl 4-hydroxylase (C-P4H9I) on AGO3,probably necessary for stability.prolyl 4-hydroxylation appears to be dispensable for miRNA-mediated translation repression. methyltransferase 5 (dPRMT5) catalyses the methylation of Ago3 and Aubergine, which enhances their stability.Methylation of Piwi proteins facilitates the recruitment of multiple members of the Tudor family, which may assist in piRNA production and loading of Piwi protein.Ubiquitinated on surface-exposed lysines by a SCF-like E3 ubiquitin-protein ligase complex during degradation of microRNAs (miRNAs).
Bibliography Huang H, Li Y, Szulwach KE, Zhang G, Jin P, Chen D. AGO3 Slicer activity regulates mitochondria-nuage localization of Armitage and piRNA amplification. J Cell Biol. 2014 Jul 21;206(2):217-30. doi: 10.1083/jcb.201401002. PMID: 25049272; PMCID: PMC4107788.