Search by BoMiProt ID - Bomi8296


Primary Information

BoMiProt ID Bomi8296
Protein Name Proteasomal ubiquitin receptor ADRM1
Organism Bos taurus
Uniprot IdA1L5A6
Milk FractionWhey
Ref Sequence Id NP_001073751.1
Aminoacid Length 407
Molecular Weight 41955
Fasta Sequence https://www.uniprot.org/uniprot/A1L5A6.fasta
Gene Name ADRM1
Gene Id 519729
Protein Existence Status reviewed

Secondary Information

Protein Function Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins.It participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.
Biochemical Properties Component of the 19S proteasome regulatory particle complex. The 26S proteasome consists of a 20S core particle (CP) and two 19S regulatory subunits (RP).The Pru (pleckstrin-like receptor for ubiquitin) domain mediates interactions with PSMD1 and ubiquitin. Preferential binding to the proximal subunit of K48-linked diubiquitin allows UCHL5 access to the distal subunit.The deduced 407-amino acid ADRM1 protein has a calculated molecular mass of 41.2 kD. It has a putative N-terminal signal sequence, a potential C-terminal transmembrane region, and numerous sites for O- and N-glycosylation.The deduced 407-amino acid mouse protein shares 96% identity with the human protein. Interacts with the proteasomal scaffolding protein PSMD1.
PTMs Acetylation, Isopeptide bond, Phosphorylation,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A1L5A6|ADRM1_BOVIN Proteasomal ubiquitin receptor ADRM1 OS=Bos taurus OX=9913 GN=ADRM1 PE=2 SV=1 MTTSGALFPSLVPGS*15RGSSNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC WKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH CRKVNEY*127LNNPPMPGALGAS*140GSGGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL GGLGALTGPGLASLLGSGGPPASSSSSSSRS*211QSAAVT*217PSSTTSSTRATPAPSAPAAASAT SPSPAPSSGDGASTAASPAQPIQLSDLQSILATMSVPAGPGGGQQVDLASVLTPEIMAPI LANADVQERLLPYLPSGESLPQTAEEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG LPAEAVEAANKGDVEAFAKAMQNSASPEQQEGDGKDKKDEEEDMS*405LD
Predicted Disorder Regions 1-11, 35-38, 116-156, 174-180, 190-283, 291-302, 343-351, 363-407
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Simins AB, Weighardt H, Weidner KM, Weidle UH, Holzmann B. Functional cloning of ARM-1, an adhesion-regulating molecule upregulated in metastatic tumor cells. Clin Exp Metastasis. 1999;17(8):641-8. doi: 10.1023/a:1006790912877. PMID: 10919708. 2.Husnjak K, Elsasser S, Zhang N, Chen X, Randles L, Shi Y, Hofmann K, Walters KJ, Finley D, Dikic I. Proteasome subunit Rpn13 is a novel ubiquitin receptor. Nature. 2008 May 22;453(7194):481-8. doi: 10.1038/nature06926. PMID: 18497817; PMCID: PMC2839886.