Search by BoMiProt ID - Bomi8293


Primary Information

BoMiProt ID Bomi8293
Protein Name Prostaglandin reductase 1/PRG-1
Organism Bos taurus
Uniprot IdQ3SZJ4
Milk FractionWhey,MFGM
Ref Sequence Id NP_001030358.1
Aminoacid Length 329
Molecular Weight 35706
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZJ4.fasta
Gene Name PTGR1/LTB4DH
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Human intestine,testis,muscle tissues,cerebral cortex,kidney and liver,porcine kidney
Protein Function Prostaglandin Reductase 1 (PTGR1) is a rate-limiting enzyme involved in the arachidonic acid metabolism pathway.deactivation of some eicosanoids, including prostaglandins and leukotriene B4.
Biochemical Properties reduces the α,β-double bond in 15-keto-PGs and carbonyl compounds.Arg56 is predicted to interact with the side-chain carboxyl group of prostaglandins.PGs (such as PGE2, PGJ2, and PGF2α) are converted into 15-keto-PGs first by NAD-dependent 15-hydroxyprostaglandin dehydrogenase (15-PGDH), and then further metabolized into biologically less active 13,14-dihydro-15-keto-PGs by PTGR1. Similarly, LXA4 is oxidized to 15-keto-LXA4 by 15-PGDH and subsequently converted to 13,14-dihydro-15-keto-LXA4 by PTGR1. In comparison to 15-keto-PGE1, 15-keto-PGF1α, 15-keto-PGF2α, and LTB4, 15-keto-PGE2 is the best substrate for PTGR1 with the highest kcat/Km value. For example, the kcat/Km value for 15-keto-PGE2 reduction is approximately 200 times higher than that for LTB4 oxidation.
PTMs Acetylation on Lys and phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus OX=9913 GN=PTGR1 PE=2 SV=1 MVHAKSWTLKKHFVGYPT*18NS*20DFELKTVELPPLKDGEVLLEALYLTVDPYMRIMAKSLKEG DMMMGEQVARVVESKNSAFPTGTIVLAPSGWTTHSISNGEKLEKVLAEWPDTLPLSLALG TVGMPGLTAYFGLLDICGVKGGETVLVSAAAGAVGSIVGQIAKLKGCKVVGTAGSDEKVA WLKKHGFDVALNYKTVKSLEEALKEAAPEGYDCYFDNVGGEFSNVAITQMKKFGRIAICG AISVYNRTSPLSPGPSPEIIIFKELHLQGFVVYRWQGEVRQKALRDLLKWVSEGKIQYHE HVTEGFENMPAAFIGLLKGENLGKAIVKA
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Wang X, Yin G, Zhang W, Song K, Zhang L, Guo Z. Prostaglandin Reductase 1 as a Potential Therapeutic Target for Cancer Therapy. Front Pharmacol. 2021 Aug 6;12:717730. doi: 10.3389/fphar.2021.717730. PMID: 34421612; PMCID: PMC8377670.