Search by BoMiProt ID - Bomi8289


Primary Information

BoMiProt ID Bomi8289
Protein Name Prostaglandin E synthase 3/Cytosolic prostaglandin E2 synthase
Organism Bos taurus
Uniprot IdQ3ZBF7
Milk FractionExosomes
Ref Sequence Id NP_001007807.2
Aminoacid Length 160
Molecular Weight 18697
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBF7.fasta
Gene Name PTGES3
Gene Id 493638
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Detected in testis and ovary, at lower levels in endometrium, myometrium, kidney and lung, and only faintly in spleen, heart and muscle (at protein level). Expressed at high levels in glandular and luminal epithelial cells of the endometrium, but also detected in stromal cells 
Protein Function Prostaglandin E synthases (PGESs) convert cyclooxygenase (COX)-derived prostaglandin H2 (PGH2) into prostaglandin E2 (PGE2) and comprise at least three types of structurally and biologically distinct enzymes.
PTMs N6-Acetylation at Lys, Isopeptide bond formation, Phosphorylation at Ser, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBF7|TEBP_BOVIN Prostaglandin E synthase 3 OS=Bos taurus OX=9913 GN=PTGES3 PE=1 SV=1 MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGS*44DNFKHLNEIDLFHCID PNDSKHKRTDRSILCCLRKGESGQS*85WPRLTKERAKLNWLS*100VDFNNWKDWEDDS*113DEDMS*118NF DRFSEMMNNMGGDEDVDLPEVDGADDDS*148QDS*152DDEKMPDLE
Predicted Disorder Regions 1-7, 68-75, 107-160
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Xu D, Cai J, Wan ZK, Gao H, Sun Y. Pathophysiological role of prostaglandin E synthases in liver diseases. Prostaglandins Other Lipid Mediat. 2021 Jun;154:106552. doi: 10.1016/j.prostaglandins.2021.106552. Epub 2021 Apr 27. PMID: 33930567.