Search by BoMiProt ID - Bomi8288


Primary Information

BoMiProt ID Bomi8288
Protein Name Prostaglandin E synthase 2
Organism Bos taurus
Uniprot IdQ66LN0
Milk FractionWhey
Ref Sequence Id NP_001160026.1
Aminoacid Length 372
Molecular Weight 41738
Fasta Sequence https://www.uniprot.org/uniprot/Q66LN0.fasta
Gene Name PTGES2
Gene Id 493639
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Mainly detected in heart,followed by lungs,muscle,kidney and testis.In endometrium, it is mainly expressed in luminal epithelial cells.
Protein Function involved in the pathway prostaglandin biosynthesis, which is part of Lipid metabolism.
Biochemical Properties This isomerase catalyzes the conversion of PGH2 into the more stable prostaglandin E2.The Vmax and Km values for PGH2 of the purified recombinant mPGE synthase are about 3.3 μmol/min · mg of protein and 28 μM, respectively.Activated by various SH-reducing reagents, i.e., dithiothreitol, glutathione (GSH), and β-mercaptoethanol, in order of decreasing effectiveness.
Significance in milk During the estrus cycle, it decreases from the beginning of the cycle until days 13-15 and then increase until ovulation.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q66LN0|PGES2_BOVIN Prostaglandin E synthase 2 OS=Bos taurus OX=9913 GN=PTGES2 PE=1 SV=3 MAHAVRALWPHGRALAWRLGDRPALGLHAQSRAGFTGAAGGSGPAATARKGGPRLLGAAA LALGGALGLYHTARWHLRAQDLRAERSATQLS*92LSSRLQLTLYQYKTCPFCSKVRAFLDFH ALPYQVVEVNPVRRAEIKFSSYRKVPIVMAQEGESLQQLNDSSVIISALKTYLVSGQPLA DIITYYPPMKAVNDQGKEVTEFCNKYWLMLDEKEAQRMYGGKEARTEEMKWRQWADDWLV HLISPNVYRTPAEALASFDYIVKEGNFGTVEGAMAKYMGAAAMYFISKRLKRRHHLRDDV REDLYEAANKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLEAFDDLMRHTHIQPWY LRVEKAIAEAPQ
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Tanikawa N, Ohmiya Y, Ohkubo H, Hashimoto K, Kangawa K, Kojima M, Ito S, Watanabe K. Identification and characterization of a novel type of membrane-associated prostaglandin E synthase. Biochem Biophys Res Commun. 2002 Mar 8;291(4):884-9. doi: 10.1006/bbrc.2002.6531. PMID: 11866447.