Search by BoMiProt ID - Bomi8284


Primary Information

BoMiProt ID Bomi8284
Protein Name Prostacyclin receptor/Prostaglandin I2 receptor PGI receptor/PGI2 receptor/Prostanoid IP receptor
Organism Bos taurus
Uniprot IdP79393
Milk FractionWhey,MFGM
Aminoacid Length 385
Molecular Weight 41247
Fasta Sequence https://www.uniprot.org/uniprot/P79393.fasta
Gene Name PTGIR
Protein Existence Status reviewed

Secondary Information

Protein Function Receptor for prostacyclin (prostaglandin I2 or PGI2).G-protein coupled receptor (GPCR).prevention of atherothrombosis.Prostacyclin is a potent vasodilator, antithrombotic, and antiplatelet agent that mediates it effects through a membrane-associated receptor termed the IP.
PTMs Disulfide bond addition, Glycosylation on Asn, Methylation, Prenylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P79393|PI2R_BOVIN Prostacyclin receptor OS=Bos taurus OX=9913 GN=PTGIR PE=3 SV=1 MADSCRN*7LTYVRDSVGPATSTLMFVAGVVGNGLALGILGARRHSRPSAFAVLVTGLGVTD LLGTCFLSPAVFAAYARNSSLLGLARGRPALCDAFAFAMTFFGLASTLILFAMAVERCLA LSHPYLYAQLDGPRRARLALPAIYAFCTIFCSLPFLGLGQHQQYCPGSWCFIRMRSAEPG GCAFLLAYASLVALLVAAIVLCNGSVTLSLCRMYRQQRRHQARCPRPRAGEDEVDHLILL ALMTGIMAVCSLPLTPQIRGFTQAIAPDSSEMGDLLAFRFNAFNPILDPWVFILFRKSVF QRLKLWFCCLYSRPAQGDSRTSLSQSASGRKDSSAPPALEGKKGNWVPLSAWGEGQGGPL PAVQLPTSTVGTPSKAGSEAACSLC
Predicted Disorder Regions 1 disordered segment; (319-381)
DisProt Annotation
TM Helix Prediction 6TMHs; (15-37), (50-72) ,(94-116) ,(136-158), (188-210) & (237-255)
Bibliography Smyth EM, FitzGerald GA. Human prostacyclin receptor. Vitam Horm. 2002;65:149-65. doi: 10.1016/s0083-6729(02)65063-0. PMID: 12481546.