Search by BoMiProt ID - Bomi8261


Primary Information

BoMiProt ID Bomi8261
Protein Name Proline-rich protein 14
Organism Bos taurus
Uniprot IdQ0VBZ8
Milk FractionWhey
Ref Sequence Id NP_001030473.1
Aminoacid Length 587
Molecular Weight 64437
Fasta Sequence https://www.uniprot.org/uniprot/Q0VBZ8.fasta
Gene Name PRR14
Gene Id 533235
Protein Existence Status reviewed

Secondary Information

Protein Function Acts as a diagnostic Biomarker for Parkinson's Disease.
Biochemical Properties this protein is involved in the nuclear morphological alteration and activation of the mTOR (mammalian target of rapamycin) signaling pathway.
PTMs Acetylation at Meth and Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VBZ8|PRR14_BOVIN Proline-rich protein 14 OS=Bos taurus OX=9913 GN=PRR14 PE=2 SV=1 MDLPGDSSTPGRQRLCRQPHAGALWGAKSPKRPKLQPLGAPSPLEKASRRVLAVVLEDVM AARMVPLEPQEESSTPRHHSNHRDSVRSQPPASPPRQAMWSPQARPPDPLHLCREPLSRI RRPPSTPRRQSRTTPGPDEGPSQKVDQVHQPTLVVMLQDIASSRPRAEGFADEAPNFIIP ARRAEPKVMVHQPKPPSRDLPAPSRPSALSANPLASPPPAPDPVLEPPSTPPPSSLLRPR LSPWGLAPLFHSVRSKLESFADIFLTPNKAPRPPPPS*277PPMKLELKIAISEAGQPGASEGT VTVSPRPPIRQWRAQDQNPSATLTKPSLGRSHSCPDLGPPGPDPCSWPPVPAPSSRPRPR RHTVGGGEMAKAPPPPRPCLRKEVFPLGGVGASPPLVTSCSSTASTSSFSEPAEPRLSST KRKEPRAPEDQVLPDSETKTIGKVSRFRIRRTPARSQINLTPMGLPRPVRLNKKEFSLEE IYTNKNYQSPTTRRTFETIFEEPRERNGTLIFTSSRKLRRTVEFRDSSLPRSRRPSRGAR ATAGRTLPPSLAPSPDVEPLLQQRLQELDASLLEEEEEGDQDQPHRT
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Salivary proline-rich protein may reduce tannin-iron chelation.
Bibliography 1.Jin T, Tan X, Shi X, Lv L, Peng X, Zhang H, Tang B, Wang C, Yang M. Preliminary Findings on Proline-Rich Protein 14 as a Diagnostic Biomarker for Parkinson's Disease. Neuromolecular Med. 2021 Jun;23(2):285-291. doi: 10.1007/s12017-020-08617-z. Epub 2020 Oct 1. PMID: 33001354; PMCID: PMC8128746. 2.Jin T, Tan X, Shi X, Lv L, Peng X, Zhang H, Tang B, Wang C, Yang M. Preliminary Findings on Proline-Rich Protein 14 as a Diagnostic Biomarker for Parkinson's Disease. Neuromolecular Med. 2021 Jun;23(2):285-291. doi: 10.1007/s12017-020-08617-z. Epub 2020 Oct 1. PMID: 33001354; PMCID: PMC8128746. 3.Delimont NM, Rosenkranz SK, Haub MD, Lindshield BL. Salivary proline-rich protein may reduce tannin-iron chelation: a systematic narrative review. Nutr Metab (Lond). 2017 Jul 24;14:47. doi: 10.1186/s12986-017-0197-z. PMID: 28769992; PMCID: PMC5525358.