Search by BoMiProt ID - Bomi8257


Primary Information

BoMiProt ID Bomi8257
Protein Name Proline/serine-rich coiled-coil protein 1
Organism Bos taurus
Uniprot IdQ29RJ9
Milk FractionWhey
Ref Sequence Id NP_001039966.1
Aminoacid Length 326
Molecular Weight 34326
Fasta Sequence https://www.uniprot.org/uniprot/Q29RJ9.fasta
Gene Name PSRC1
Gene Id 541250
Protein Existence Status reviewed

Secondary Information

Protein Function  PSRC1 protects against the development of atherosclerosis and enhances the stability of plaques by modulating cholesterol transportation and inflammation in macrophages and the liver of apoE-/- mice.
Biochemical Properties Psrc1 may mediate the interactions between p53 and other signaling pathways and contribute to the complexity and specificity of the p53 signaling network.
PTMs Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RJ9|PSRC1_BOVIN Proline/serine-rich coiled-coil protein 1 OS=Bos taurus OX=9913 GN=PSRC1 PE=2 SV=1 MEDLEEDVKFIADETLDFGGLS*22PSDSREEEDVAVLVTPEKPLRRGLS*47HRSDPNAVAPTPQ GLRLS*65LGPLS*70PEKLEEILHEANRLAAQLEQCALKERENTGEGSGPRRVKPSPRRETFVLK DS*122PVRDLLPTVSSLARSTPS*140PSSLT*145PRLRSSDRKGSIRALRATSGKKPSSVKRESPTCNL FPASKS*186PASS*190PLARSAPPVRGKAGPSGRATASPPTPVRPVLAPQPPAGSSQRPSRPQGAA AKPSSRLPVPSAVPRPGNRMPLASRSVPSSKGAPPSDSLSARKGLPRPSAAGHRVPVSQR PNLPISGAGRSNLQPPRKVAVPGSTR
Predicted Disorder Regions 1-80, 86-257, 267-294, 319-326
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments PSRC1 overexpression attenuates atherosclerosis progression in apoE -/- mice by modulating cholesterol transportation and inflammation
Bibliography 1.Guo K, Hu L, Xi D, Zhao J, Liu J, Luo T, Ma Y, Lai W, Guo Z. PSRC1 overexpression attenuates atherosclerosis progression in apoE-/- mice by modulating cholesterol transportation and inflammation. J Mol Cell Cardiol. 2018 Mar;116:69-80. doi: 10.1016/j.yjmcc.2018.01.013. Epub 2018 Feb 3. PMID: 29378206.