Search by BoMiProt ID - Bomi8231


Primary Information

BoMiProt ID Bomi8231
Protein Name Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
Organism Bos taurus
Uniprot IdO77588
Milk FractionWhey,Casein
Ref Sequence Id NP_776573.1
Aminoacid Length 726
Molecular Weight 83487
Fasta Sequence https://www.uniprot.org/uniprot/O77588.fasta
Gene Name PLOD1
Gene Id 281409
Protein Existence Status Reviewed

Secondary Information

Protein Function collagen-related lysyl hydroxylase take part in collagen fibril formation.PLOD1 can hydroxylate lysyl residues during peptide bond formation and consequently acts as an important enhancer of collagen fibril deposition and cross-link stabilization.
Biochemical Properties Forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens.Protein has several cofactor binding sites for Fe2+ and Ascorbate. 2-oxoglutarate + L-lysyl-[collagen] + O2 = (5R)-5-hydroxy-L-lysyl-[collagen] + CO2 + succinate
PTMs Glycosylation on Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O77588|PLOD1_BOVIN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Bos taurus OX=9913 GN=PLOD1 PE=2 SV=2 MRLLLLLAPLGWLLLAETKGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGL GEDWPGEAMLAGGGLKVRLLKKALEKHADKENLVILFTDSYDVVFASGPRELLKKFRQAR SQVVFSAEELIYPDRRLEAKYPVVSDGKRFLGSGGFIGYAPNLSKLVAEWEGQDSDSDQL FYTKIFLDPEKREQIN*196ITLDHRCRIFQNLDGALDEVVLKFEMGQVRARNLAYDTLPVLIH GNGPTKLQLNYLGNYIPRFWTFETGCAVCDEGLRSLKGIGDEALPAVLVGVFIEQPTPFL SLFFQRLLRLHYPQKRLRLFIHNHEQHHKAQVEQFLAEHGDEYQSVKLVGPEVRVANADA RNMGADLCRQDRGCTYYFSVDADVALTEPKTLRLLIEQNKNVIAPLMTRHGRLWSNFWGA LSADGYYARSEDYVDIVQGRRVGVWNVPYISNIYLIKGSALRAELQETDLFHHSKLDPDM AFCANIRQQDVFMFLTNRHSFGHLLSLDSYQTTHLHNDLWEVFSNPEDWKEKYIHEN*537YTK ALAGKMVEMPCPDVYWFPIFTETACDELVEEMEHYGQWSLGDNKDNRIQGGYENVPTIDI HMNQINFEREWHKFLVEYIAPMTEKLYPGYYTRAQFDLAFVVRYKPDEQPSLVPHHDAST FTINIALNRVGVDYEGGGCRFLRYN*685CSIRAPRKGWTLMHPGRLTHYHEGLPTTKGTRYIA VSFVDP
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments PLOD1 is dysregulated in bladder cancer lesions and that silencing PLOD1 can significantly impair proliferation, migration, and invasion in bladder cancer cells.High expression levels of PLODs have been observed in various cancer types, and have been found to regulate tumor growth, invasion and metastasis, as well as radio-resistance.
Bibliography 1.Yuan B, Xu Y, Zheng S. PLOD1 acts as a tumor promoter in glioma via activation of the HSF1 signaling pathway. Mol Cell Biochem. 2022 Feb;477(2):549-557. doi: 10.1007/s11010-021-04289-w. Epub 2021 Nov 29. PMID: 34845571.