Search by BoMiProt ID - Bomi8217


Primary Information

BoMiProt ID Bomi8217
Protein Name Probable G-protein coupled receptor 158
Organism Bos taurus
Uniprot IdE1BBQ2
Milk FractionWhey
Aminoacid Length 1216
Molecular Weight 135363
Fasta Sequence https://www.uniprot.org/uniprot/E1BBQ2.fasta
Gene Name GPR158
Protein Existence Status reviewed

Secondary Information

Protein Function Predicted to enable G protein-coupled receptor activity. Predicted to act upstream of or within G protein-coupled receptor signaling pathway and protein localization to plasma membrane. Predicted to be located in membrane.
Biochemical Properties Most Family C GPCRs containan N-terminal Venus Fly Trap (VFT) domain that is linked to the 7TM domain via the cysteine-rich domain (CRD) and plays an important role in ligand recognition. While GPPR158 lacks the VFT domain.GPR158 contains several potential Nglycosylation sites, all of them located in the N-terminal domain, but no O-glycosylation sites.
PTMs N-Linked Glycosylation at Asn, Isopeptide bond formation, Phosphorylation at Ser, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BBQ2|GP158_BOVIN Probable G-protein coupled receptor 158 OS=Bos taurus OX=9913 GN=GPR158 PE=3 SV=2 MGVMAYPFLFCLLLVHFGLGAIGASREAPSRPDPPRERTLRAKQHAQQPARASASDPSAP WSRSTDGTILAQKLAEEVPMDVASYLYTGDSHKLKRAN*98CSSRYELAGLPGKSPALASSHP SLHGALDTLTHATNFLNMMLQSN*143KSREQNLQDDLEWYQALVRSLLEGEPSISRAAITFST ESLSAPAPQVFLQATREESRILLQDLSSSAHHLAN*215ATLETEWFHGLRRKWRTHLHRRGSN QGPRGLGHSWRRRDGLSGDKSHVKWSPPYLECEN*274GSYKPGWLVTLSAAFYGLQPNLVPEF RGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLN*333NSECMPIKGLGFVLGAYQCICKAGFYH PRDFSFNNFQRRGPDHHFVESAKDVSEEVHVCLPCSEGCPYCADDSPCFVQEDKYLRLAI ISFQALCMLLDFLSMLVVYRFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFR CILLRWVRLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWF LVGWTSSVCQNLERHISLIGQGRTSDHLIFSMCLVERWDYMTAAAEFLFLLWGVYLCYAV RTVPSAFHEPRYMAVAVHNELIISAIFHTIRFVLASRLQSDWMLMLYFAHTHLTVTVTIG LLLIPKFSHSSNNPRDDIATEAYEDELDMGRSGS*694YLNSSINSAWS*705EHS*708LDPEDIRDELKK LYAQLEIYKRKKMITNNPHLQKKRCSKKGLGRSIMRRITEIPETVSRQCSKEDKDGGEHG SAKGSSAGRKNPQETAGGSGKPKEESLRSRVFSLKKSHSTYEHVREQPGGPGSPPAQSRE EEEATDNSVLGSPVGANRPRPLQEDS*866QAVSTESVPLVCKSASAHNLSSEKKPGPTRTSVL QKSLSVIASAKEKTLGLAGKTQAACVEERAKAQKALPRERETNRKYS*947NSDNAETQDSAPP NSSHSEEPRKPQKLGIMKQQRANPTTANSDLSPGATHMKDNFDIGEVCPWEIYDLAPGPG PLESKVQKHVSIAASEMERNPTFSLKEKSHPKPKAADLCQQSNPKS*1066VDKAEVCPWESQGQ S*1081LFEEEKYLMSKTQVPLGRAQGENSGQHCATGVCAGQCEELPPKAVASKVENENLNQLGE QEKKTSSSERNVPDSHNSSNNFQPPLMSRAEVCPWEFETPDKPNAERSVAFPASSALSAN KIAGPRNEEVRLARKV
Predicted Disorder Regions 27-62, 741-751, 774-1201
DisProt Annotation
TM Helix Prediction 7TMHs; (3-25), (421-439),(452-474),(489-507),(530-548),(613-635),(642-664)
Additional Comments GPR158 overexpression upregulates levels of the cell cycle regulator cyclin D1, but mutation of the NLS reverses this. Overexpression of GPR158 enhances the barrier function of a TBM cell monolayer, which is associated with an increase in the levels of tight junction proteins ZO-1 and occludin, similar to reported studies on GC treatment
Bibliography 1.Patel N, Itakura T, Gonzalez JM Jr, Schwartz SG, Fini ME. GPR158, an orphan member of G protein-coupled receptor Family C: glucocorticoid-stimulated expression and novel nuclear role. PLoS One. 2013;8(2):e57843. doi: 10.1371/journal.pone.0057843. Epub 2013 Feb 25. PMID: 23451275; PMCID: PMC3581496. 2.Wellendorph P, Bra¨uner-Osborne H (2009) Molecular basis for amino acid sensing by family C G-protein-coupled receptors. Br J Pharmacol 156:869–884. 3.Kniazeff J, Pre´zeau L, Rondard P, Pin JP, Goudet C (2011) Dimers and beyond: The functional puzzles of class C GPCRs. Pharmacol Ther 130:9–25