Search by BoMiProt ID - Bomi8215


Primary Information

BoMiProt ID Bomi8215
Protein Name Probable ATP-dependent RNA helicase DDX27/DEAD box protein 27
Organism Bos taurus
Uniprot IdA1A4H6
Milk FractionWhey
Ref Sequence Id NP_001073740.1
Aminoacid Length 765
Molecular Weight 87087
Fasta Sequence https://www.uniprot.org/uniprot/A1A4H6.fasta
Gene Name DDX27
Gene Id 514567
Protein Existence Status reviewed

Secondary Information

Protein Function Probable ATP-dependent RNA helicase. Component of the nucleolar ribosomal RNA (rRNA) processing machinery that regulates 3' end formation of ribosomal 47S rRNA.regulates skeletal muscle growth and regeneration by modulation of translational processes
Biochemical Properties The C-terminal domain regulates nucleolar localization
PTMs phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus OX=9913 GN=DDX27 PE=2 SV=1 MLSELGFIRTIGEDEDVQVEPETDS*25EDEEEEGPIVLGRKQKALQKNRS*48ADFNPDFVFTEK EGMYDGSWAMADVLSQLKKKRAATTLDEKIEKVRKKRKTEDKEAKSGKSEKEKEAKEGSE PEEEEDLERKDVEAS*135EDEESETDYSS*146ADENILTKADTLKIKERKKKKKKGQEAGGFFEDA SQYDENLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAA FALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTKQLAQFCSITTCLAVGGLDVKS QEAALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRM CSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDRE AIVAALLMRTFTDHVMLFTQTKKQAHRMHILLGLMGLQVGELHGNLSQTQRLEALRRFKD EQIDILVATDVAARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEEE RKMLKEIVKAAKAPVKARILPQDVILKFRDKIEKMEKDVYAVLQLEAEEKEMQKSEAQIN TAQRLLEKGKEAPNPEPERSWFQTKEERKKEKIAKALQEFDLALRGKKKRKKFMKEAKKK GEMTAEERSQFEILKAQMFAERLAKRNRRAKRARAMPEEEPVRAPAKKQKQVKKSVFDEE LTNTSKKALKQYRAGPSFEERKKLGLPHQRRGGNFKSKSRYKRRK
Predicted Disorder Regions 1-66, 80-181, 637-665, 690-693, 722-764
DisProt Annotation
TM Helix Prediction No TM helices