Search by BoMiProt ID - Bomi8209


Primary Information

BoMiProt ID Bomi8209
Protein Name Prenylcysteine oxidase-like
Organism Bos taurus
Uniprot IdQ0P5H1
Milk FractionWhey
Ref Sequence Id NP_001069141.1
Aminoacid Length 492
Molecular Weight 54437
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5H1.fasta
Gene Name PCYOX1L
Gene Id 514598
Protein Existence Status reviewed

Secondary Information

Protein Function Maintain levels of low density lipoproteins (LDLs)
Biochemical Properties Hydrolyzes the thioether bond of prenylcysteines in the final step in the degradation of prenylated proteins, releasing hydrogen peroxide, cysteine and the isoprenoid aldehyde.
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5H1|PCYXL_BOVIN Prenylcysteine oxidase-like OS=Bos taurus OX=9913 GN=PCYOX1L PE=2 SV=1 MAHAARLLAALAALLAAAATGDARPSKIAVVGAGIGGSAVAHFLQQHFGPRVQIDVFEKG TVGGRLATISVNKQHYESGAASFHSLSLHMQGFVKQLGLRHRREVGGRSAIFNGENFVLE ETDWYLLNLFRLWWHYGISFLRLQMWVEEVMEKFMRIYKYQAHGYAFSGVEELLYSLGES AFVNMTQRSVAESLLQVGVTQRFIDDVVSAVLRASYGQSAAMPAFAGAMSLAGAQGSLWS VEGGNKLVCSGLLKLTKANVIHATVTTVTLQPTEGKPLYRVRYENEAGTGSDNYDIVVIA TPLHLDNSSTIAFEGFDPPIDVVQGSFQPTIVSLVHGYLN*340SSYFGFPDPKLFPFANILTT DFPTFFCALDNICPVNISASFRRKQPQEAAVWRVQSPQPLLRSQLKTLFRSYYSVQTAEW QAHPVHSPHTPLPRFTLHDQLFHLNALEWAASSVEVTAVAAKNVALLAFNRWYQDLDKID QKDLMHKVKTEL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Ellinger, J., Alam, J., Rothenburg, J., Deng, M., Schmidt, D., Syring, I., Miersch, H., Perner, S., & Müller, S. C. (2015). The long non-coding RNA lnc-ZNF180-2 is a prognostic biomarker in patients with clear cell renal cell carcinoma. American journal of cancer research, 5(9), 2799–2807.