Search by BoMiProt ID - Bomi8208


Primary Information

BoMiProt ID Bomi8208
Protein Name Pre-mRNA-splicing factor SLU7
Organism Bos taurus
Uniprot IdQ3ZBE5
Milk FractionWhey
Ref Sequence Id NP_001160089.1
Aminoacid Length 586
Molecular Weight 68203
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBE5.fasta
Gene Name SLU7
Gene Id 512318
Protein Existence Status reviewed

Secondary Information

Protein Function required for cleavage of the 3' splice site and exon ligation during splicing.SLU7 is only required when the interval between the branchpoint and the 3' splice site is greater than 7 nt.SLU7 is necessary for the correct expression of Pri-miR-17-92 to generate the miRNAs contained in this cluster. The expression of these miRNAs is necessary to inhibit oxidative stress, autophagy and apoptosis.
PTMs Acetylation, Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBE5|SLU7_BOVIN Pre-mRNA-splicing factor SLU7 OS=Bos taurus OX=9913 GN=SLU7 PE=2 SV=2 MSAAAVDAANAAPLSGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDIN PHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQYSSSGEWYKRGVKENSITTKYRKGAC ENCGAMTHKKKDCFERPRRVGAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMK IVEEYAKVDLAKRTLKAQKLQEELASGKLVEQANS*215PKHQWGEEEPNS*227QTEKDHNS*235EDEDE DKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANA GKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDKGSEVHLQADPTKLELLYKSFKVK KEDFKEQQKESILEKYGGQEHLDAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYE EDVKINNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKEIANSEECIINDATGEESV KKPQTLMEIHQEKLKEEKKKKKKKKRKHRKSSSESDDEEKKHEKLKKALNAEEARLLHVK EIMQIDERKRPYNSIYETREPTEEEMEAYRMKRQRPDDPMASFLGQ
Predicted Disorder Regions 9-58, 71-103, 120-146, 164-174, 206-246, 286-306, 471-521
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Urtasun, R., Elizalde, M., Azkona, M. et al. Splicing regulator SLU7 preserves survival of hepatocellular carcinoma cells and other solid tumors via oncogenic miR-17-92 cluster expression. Oncogene 35, 4719–4729 (2016). https://doi.org/10.1038/onc.2015.517 2.Brys A, Schwer B. Requirement for SLU7 in yeast pre-mRNA splicing is dictated by the distance between the branchpoint and the 3' splice site. RNA. 1996 Jul;2(7):707-17. PMID: 8756413; PMCID: PMC1369409.