Search by BoMiProt ID - Bomi8206


Primary Information

BoMiProt ID Bomi8206
Protein Name Pre-mRNA-processing factor 6/PRP6 homolog/U5 snRNP-associated 102 kDa protein/U5-102 kDa protein
Organism Bos taurus
Uniprot IdQ2KJJ0
Milk FractionWhey
Ref Sequence Id NP_001039840.1
Aminoacid Length 941
Molecular Weight 106678
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJJ0.fasta
Gene Name PRPF6
Gene Id 534228
Protein Existence Status reviewed

Secondary Information

Protein Function role in pre-mRNA splicing.Nuclear export.PRPF6 associates with histone methyltransferase or demethylase to coactivate Androgen receptor-mediated transactivation.
PTMs phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJJ0|PRP6_BOVIN Pre-mRNA-processing factor 6 OS=Bos taurus OX=9913 GN=PRPF6 PE=2 SV=1 MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQM KKSQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERR EQREKEEIEKYRMERPKIQQQFS*143DLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLT*180 PVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM RKIGQARNTLMDMRLSQVSDSVSGQT*266VVDPKGYLT*275DLNS*279MIPTHGGDINDIKKARLLLKS VRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKA VVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDAR IMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT QMVEKIIDRAITSLRANGVEINREQWIQDAEECDKAGSVATCQAVMRAVIGIGIEEEDRK HTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRA VAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENNEYER ARRLLAKARSSAPTARVFMKSVKLEWVLGNLVAAQELCEEALKHYEDFPKLWMMKGQIEE QEELVEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGLW LESVRLEYRAGLKNIASTLMAKALQECPNSGVLWSEAIFLEARPQRKTKSVDALKKCEHD PHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQREEVRRR CENAEPRHGELWCATSKDIANWQRKIGEILVLVAARIKNTF
Predicted Disorder Regions 1-13, 42-97, 125-159, 178-181, 202-218
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Liu W, Wang C, Wang S, Zeng K, Wei S, Sun N, Sun G, Wang M, Zou R, Liu W, Lin L, Song H, Jin Z, Zhao Y. PRPF6 promotes androgen receptor/androgen receptor-variant 7 actions in castration-resistant prostate cancer cells. Int J Biol Sci. 2021 Jan 1;17(1):188-203. doi: 10.7150/ijbs.50810. PMID: 33390843; PMCID: PMC7757026.