Search by BoMiProt ID - Bomi8202


Primary Information

BoMiProt ID Bomi8202
Protein Name Prefoldin subunit 4
Organism Bos taurus
Uniprot IdQ2TBR6
Milk FractionWhey,exosome
Ref Sequence Id NP_001033629.1
Aminoacid Length 134
Molecular Weight 15328
Fasta Sequence https://www.uniprot.org/uniprot/Q2TBR6.fasta
Gene Name PFDN4
Gene Id 514621
Protein Existence Status reviewed

Secondary Information

Protein Function binds and stabilizes newly synthesized polypeptides.
Biochemical Properties Heterohexamer of two PFD-alpha type and four PFD-beta type subunits.
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2TBR6|PFD4_BOVIN Prefoldin subunit 4 OS=Bos taurus OX=9913 GN=PFDN4 PE=2 SV=1 MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACEDIMLA DDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLY AKFGS*125NINLEADES
Predicted Disorder Regions 1-21, 28-34, 78-92, 126-134
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs N-terminal acetylation may be for molecular function, for thermal stability or for efficient complex assembly.
Bibliography Falb M, Aivaliotis M, Garcia-Rizo C, Bisle B, Tebbe A, Klein C, Konstantinidis K, Siedler F, Pfeiffer F, Oesterhelt D. Archaeal N-terminal protein maturation commonly involves N-terminal acetylation: a large-scale proteomics survey. J Mol Biol. 2006 Oct 6;362(5):915-24. doi: 10.1016/j.jmb.2006.07.086. Epub 2006 Aug 3. PMID: 16950390.