Primary Information |
---|
BoMiProt ID | Bomi8202 |
---|
Protein Name | Prefoldin subunit 4 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q2TBR6 |
---|
Milk Fraction | Whey,exosome |
---|
Ref Sequence Id | NP_001033629.1 |
---|
Aminoacid Length | 134 |
---|
Molecular Weight | 15328 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q2TBR6.fasta |
---|
Gene Name | PFDN4 |
---|
Gene Id | 514621 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | binds and stabilizes newly synthesized polypeptides. |
---|
Biochemical Properties | Heterohexamer of two PFD-alpha type and four PFD-beta type subunits. |
---|
PTMs | Acetylation and phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2TBR6|PFD4_BOVIN Prefoldin subunit 4 OS=Bos taurus OX=9913 GN=PFDN4 PE=2 SV=1
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACEDIMLA
DDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLY
AKFGS*125NINLEADES
|
---|
Predicted Disorder Regions | 1-21, 28-34, 78-92, 126-134 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | N-terminal acetylation may be for molecular function, for thermal stability or for efficient complex assembly. |
---|
Bibliography | Falb M, Aivaliotis M, Garcia-Rizo C, Bisle B, Tebbe A, Klein C, Konstantinidis K, Siedler F, Pfeiffer F, Oesterhelt D. Archaeal N-terminal protein maturation commonly involves N-terminal acetylation: a large-scale proteomics survey. J Mol Biol. 2006 Oct 6;362(5):915-24. doi: 10.1016/j.jmb.2006.07.086. Epub 2006 Aug 3. PMID: 16950390. |