Search by BoMiProt ID - Bomi8199


Primary Information

BoMiProt ID Bomi8199
Protein Name Pre-B-cell leukemia transcription factor-interacting protein 1
Organism Bos taurus
Uniprot IdA6QLY7
Milk FractionWhey
Ref Sequence Id NP_001068733.1
Aminoacid Length 727
Molecular Weight 80258
Fasta Sequence https://www.uniprot.org/uniprot/A6QLY7.fasta
Gene Name PBXIP1
Gene Id 506485
Protein Existence Status reviewed

Secondary Information

Protein Function Regulator of pre-B-cell leukemia transcription factors (BPXs) function. Inhibits the binding of PBX1-HOX complex to DNA and blocks the transcriptional activity of E2A-PBX1. Tethers estrogen receptor-alpha (ESR1) to microtubules and allows them to influence estrogen receptors-alpha signaling
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLY7|PBIP1_BOVIN Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Bos taurus OX=9913 GN=PBXIP1 PE=2 SV=1 MASCPDSDNSWVLAGSESLPVETLGPESGNDPESERAPRAPQS*43PSRAAAEESAGTLDGGE TVSQNESSKSGPILSEEAEAKQGVLEGDDPGVESPGPGDTEAQGDLEETPEVVGLEPDSQ DLEDQSPHRS*130LPSS*134PKTAWIREEAHHS*147S*148S*149DDDT*153DVDVEGLRRRRGREPGTPQPAATLGVEDQVQGEGAGGQLGISLNMCLLGSLVLLGLGVLLFGGLSESESGPLEEVDLQVLPDVESDT EMLEAVGDGQDGLQQLQTSEVLDSVPSLQNMALLLDKLAKENQDIRLLQAQLQAQKEELQ SLMRQPKGLEEENARLRGALQQGEASQRALESELQQLRAQLQGLEADCVQGADGLCLQWG RGPQAGQVTKEQGPTGQEPSPGFLEQKKQLEAEAQALRQELERQRRLLGSVQQDLERSLK EAGRGDPARAGLAELGHRLAQKLRGLENWGQHPGVPANVSEAWHQKPHFQNSREPSGKEK WWDRQGDWKTEHWKHKKEASGREKSWRGEEDRELVGRRKEGKPRVEEWAGKKDGKQQRSK EPPRKSGRPHPSGERQKHPRWKEGAKDRHDPLPLWAELSRHKYQAPQGCSGVHECARQEG LAFFGIELAPVRQQELASLLRTYLARLPWAGPLTEELPLSPAYFGEDGIFRHDRLRFRDF VDALEDQLEEVAVRQTGDDDAVDDFEDFIFSHFFGDKALKKRSGKKDKHLQNRVVGPREE HSPHRQG
Predicted Disorder Regions 1-135, 491-568, 701-727
DisProt Annotation
TM Helix Prediction No TM helices