Search by BoMiProt ID - Bomi8177


Primary Information

BoMiProt ID Bomi8177
Protein Name POU domain, class 5, transcription factor 1/Octamer-binding protein 3/Octamer-binding transcription factor 3
Organism Bos taurus
Uniprot IdO97552
Milk FractionWhey
Aminoacid Length 360
Molecular Weight 38289
Fasta Sequence https://www.uniprot.org/uniprot/O97552.fasta
Gene Name POU5F1/OCT3
Protein Existence Status reviewed

Secondary Information

Protein Function Bovine blastocyst formation.transcription factor and master regulator of cell pluripotency with indispensable roles in early embryo development and cell lineage specification.
Biochemical Properties binding to a specific octameric sequence motif (ATGCAAT) on enhancer and promoter regions of target genes through POU domain to activate and repress gene expression.
PTMs Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O97552|PO5F1_BOVIN POU domain, class 5, transcription factor 1 OS=Bos taurus OX=9913 GN=POU5F1 PE=2 SV=1 MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWMSFQGPPGGSGIGPGVVPGAEVWGL PPCPPPYDLCGGMAYCAPQVGVGPVPPGGLETPQPEGEAGAGVESNSEGAS*111PDPCAAPAG APKLDKEKLEPNPEESQDIKALQKDLEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRT*235S*236IENR VRGNLESMFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS*289S*290DYSQREDFEA AGSPFTGGPVSSPLAPGPHFGTPGYGGPHFTTLYSSVPFPEGEVFPSVSVTALGS*355PMHAN
Predicted Disorder Regions 4 disordered segments; (4-52), (74-140), (287-294), (303-334)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Daigneault BW, Rajput S, Smith GW, Ross PJ. Embryonic POU5F1 is Required for Expanded Bovine Blastocyst Formation. Sci Rep. 2018 May 17;8(1):7753. doi: 10.1038/s41598-018-25964-x. PMID: 29773834; PMCID: PMC5958112.