Search by BoMiProt ID - Bomi8169


Primary Information

BoMiProt ID Bomi8169
Protein Name Potassium voltage-gated channel subfamily D member 1/Voltage-gated potassium channel subunit Kv4.1
Organism Bos taurus
Uniprot IdQ52PG9
Milk FractionWhey
Ref Sequence Id NP_001019724.1
Aminoacid Length 648
Molecular Weight 71378
Fasta Sequence https://www.uniprot.org/uniprot/Q52PG9.fasta
Gene Name KCND1
Gene Id 518384
Protein Existence Status Reviewed

Secondary Information

Protein Function voltage-activated A-type potassium ion channels which functions in the repolarization of membrane action potentials. Activity of voltage-gated potassium channels is important in a number of physiological processes, among them the regulation of neurotransmitter release, heart rate, insulin secretion, and smooth muscle contraction. [
Biochemical Properties It contains 6 potential membrane-spanning hydrophobic segments, a pore domain with the K+ channel signature motif 'GYGD,' and intracellular N- and C-termini, but no N-glycosylation sites.
PTMs phosphorylation on Ser and N linked glycosylation on Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q52PG9|KCND1_BOVIN Potassium voltage-gated channel subfamily D member 1 OS=Bos taurus OX=9913 GN=KCND1 PE=2 SV=1 MAAGVATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR YPDTLLGSSEKEFFYNADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPTLPAGSSLRQRLWRAFENPH TSTAALVFYYVTGFFIAVSVIANVVETIPCRSPTRRPPREQPCGDRFPLAFFCMDTACVL IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFMPKNEDVSGAFVTLRVFRVF RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTN*352KTN*355FTSIP AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGSLEDS*458GGGEEQALCVRNRSAFEQQHHH LLHCLEKTTCHEFTDELTFSEALGAVSLGSRTSRSTSVSSQPVGAGSLLSSCCPRRAKRR AIRLANSTASVSRGS*555MQELDTLAGLRRSPAPQSRSSLNAKPHDSLDLTCDSRDFVAAIIS IPTPPANTPDESQPSSPGGGGGGASSTLRNSSLGTPCLLPETVKISSL
Predicted Disorder Regions 31-33,155-164, 511-648
DisProt Annotation
TM Helix Prediction 5TMHs; (183-205),(259-281), ( 326-348),( 361-383),(387-409) and (961-979)
Bibliography Isbrandt D, Leicher T, Waldschütz R, Zhu X, Luhmann U, Michel U, Sauter K, Pongs O. Gene structures and expression profiles of three human KCND (Kv4) potassium channels mediating A-type currents I(TO) and I(SA). Genomics. 2000 Mar 1;64(2):144-54. doi: 10.1006/geno.2000.6117. PMID: 10729221.