Search by BoMiProt ID - Bomi8158


Primary Information

BoMiProt ID Bomi8158
Protein Name Potassium channel subfamily K member 1
Organism Bos taurus
Uniprot IdQ0P5A0
Milk FractionExosomes
Ref Sequence Id NP_001068675.1
Aminoacid Length 336
Molecular Weight 38041
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5A0.fasta
Gene Name KCNK1
Gene Id 505563
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells caput epididymis
Protein Function It is a type of Ion channel that contributes to passive transmembrane potassium transport and to the regulation of the resting membrane potential in brain astrocytes, but also in kidney and in other tissues. Forms dimeric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel is selective for K+ ions at physiological potassium concentrations and at neutral pH, but becomes permeable to Na+ at subphysiological K+ levels and upon acidification of the extracellular medium. The homodimer has very low potassium channel activity, when expressed in heterologous systems, and can function as weakly inward rectifying potassium channel.
PTMs Disulfide bond formation,N-Linked Glycosylation at Asn, Isopeptide bond formation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5A0|KCNK1_BOVIN Potassium channel subfamily K member 1 OS=Bos taurus OX=9913 GN=KCNK1 PE=2 SV=1 MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK RRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSN*95ASGNWNWDFTSALFFASTVLSTTGY GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTIHVTRRPVLYFHVRWGFSKQAVA IVHAVLLGVVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKEEDQMHIIEHDQLS FSSITDQAAGVQEDQKQNEPFVSPQPPALADGASDH
Predicted Disorder Regions 304-336
DisProt Annotation
TM Helix Prediction 5TMHs; (20-42),(135-153),(178-200),(215-237),(244-266)
Significance of PTMs  Sumoylation of KCNK1 is sufficient to silence heterodimeric channels formed by KCNK1 and KCNK3 or KCNK9.