Search by BoMiProt ID - Bomi8150


Primary Information

BoMiProt ID Bomi8150
Protein Name Polypyrimidine tract-binding protein 1
Organism Bos taurus
Uniprot IdQ8WN55
Milk FractionWhey
Ref Sequence Id NP_776867.1
Aminoacid Length 531
Molecular Weight 57105
Fasta Sequence https://www.uniprot.org/uniprot/Q8WN55.fasta
Gene Name PTBP1
Protein Existence Status reviewed

Secondary Information

Protein Function growth and differentiation of neuronal cells and activation of immune cells.Plays a role in pre-mRNA splicing.Activates exon skipping of its own pre-mRNA during muscle cell differentiation. promote the binding of U2 snRNP to pre-mRNA.
PTMs Acetylation on Met,Phosphorylation on Ser ,Thr and Tyr, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q8WN55|PTBP1_BOVIN Polypyrimidine tract-binding protein 1 OS=Bos taurus OX=9913 GN=PTBP1 PE=2 SV=1 MDGIVPDIAVGTKRGS*16DELFSACVTNGPFIMSGTSASTANGNDSKKFKGDSRSAGVPSRV IHIRKLPGDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMHTEEAANTMVNYYTSVTPV LRGQPIY*127IQFSNHKELKT*138DSS*141PNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQ SPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLS LDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLS VPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNS*433VLLVSNLNPERVTPQSLFILFGV YGDVQRVKVLFNKKENALVQMADGSQAQLAMSHLNGHKLHGKPVRITLSKHQSVQLPREG QEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSISEDDLKILFSSNGGI VKGFKFFQKDRKMALIQMGSVEEAIQALIDLHNHDLGENHHLRVSFSKSTI
Predicted Disorder Regions 4 disordered segments; (33-57), (136-148), (272-285), (399-407)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Zhu W, Zhou BL, Rong LJ, Ye L, Xu HJ, Zhou Y, Yan XJ, Liu WD, Zhu B, Wang L, Jiang XJ, Ren CP. Roles of PTBP1 in alternative splicing, glycolysis, and oncogensis. J Zhejiang Univ Sci B. 2020 Feb.;21(2):122-136. doi: 10.1631/jzus.B1900422. Epub 2020 Feb 5. PMID: 32115910; PMCID: PMC7076342.