Search by BoMiProt ID - Bomi8135


Primary Information

BoMiProt ID Bomi8135
Protein Name Polycystin-2/Polycystic kidney disease 2 protein homolog/Transient receptor potential cation channel subfamily P member 2
Organism Bos taurus
Uniprot IdQ4GZT3
Milk FractionWhey
Aminoacid Length 970
Molecular Weight 109789
Fasta Sequence https://www.uniprot.org/uniprot/Q4GZT3.fasta
Gene Name PKD2
Gene Id 530393
Protein Existence Status reviewed

Secondary Information

Protein Function transient receptor potential channel
Biochemical Properties contains 6 transmembrane regions, a pore-forming loop, N-glycosylation and phosphorylation sites, a polycystin-specific ‘tetragonal opening for polycystins’ (TOP) domain,and a C-terminal tail that includes a Ca2+-binding EF hand, coiled-coil domain, and ER retention tag.
PTMs phosphorylation and glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q4GZT3|PKD2_BOVIN Polycystin-2 OS=Bos taurus OX=9913 GN=PKD2 PE=2 SV=1 MVNSSRVQPQQPGDARRSPAPRAPGPGRLMAGGAIAGAGLAAPGGLREQRGLEIEMERIR QAAARDPPAGASASPS*76PPLS*80SCSRQAWSRDNPGFEAEEEEEEEEVEGEEGGMVVEMDVEW RPGSRRSASSSAVSSAGARGRGLGGYHGAGHPSGRRRQREDQGPPSPSPAGGGDPLHRHL PLDGQHPRVAWAERLVRGLRGLWGTRLMEESSTDREKYLKSVLRELATYLLFLIVLCILT YGMMSSSVYYYTRIMSQLFLDTPVSKMEKTNFKTLSSMEDFWKFTEGALLDGLYWKTQPS N*301RTEADN*307RSFIYYENLLLGVPRIRQLRVRN*330GSCSIPLDLRDEIKECYDVYSVSSEDRAPF GPRN*364GTAWIYTSEKDLN*377GSSHWGMIATYSGAGYYLDLSRTREETAAQVANLKKNVWLDRG TRAIFIDFTVYNANINLFCVIRLLIEFPATGGVIPSWQFQPVKLIRYVTTFDFFLAACEI IFCLFILYYVVEEILEIRIHKLHYFRSFWNCLDVVIIVLSVVAIGINIYRTSNVEALLQF LEDQNTFPNFENLAYWQTQFNNIAAVIVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLF GFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGP IYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALIKLKLK KNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQM RDDLEKEREDLDLDHSSLPRPMS*803SRSFPRS*810LDDS*814EEEDDDDSGHSSRRRGS*831ISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDN EIHREQMERLVREELERWESDDAASQISHGLGTPLGLNGQPRPRSSRPSSSQSTEGMEGG GGNGSANIHV
Predicted Disorder Regions 1-20, 68-140, 144-165, 766-833, 906-969
DisProt Annotation
TM Helix Prediction 7TMHs; (227-249), (432-454), (473-491), (504-526), (563-581), (599-621), (660-682)
Significance of PTMs Ser801 phosphorylation by protein kinase D (PrKD) is required for proper cell proliferation and inositol trisphosphate (InsP3)-mediated ER Ca2+ release.Constitutive Ser812 phosphorylation by casein kinase 2 (CK2) is critical to maintain proper Ca2+ dependence of PC2 along with its retrograde transport.Ser829 phosphoserine site is also thought to enhance InsP3-mediated Ca2+ transients. Phosphorylation and dephosphorylation of Ser534 by CK2 and calcineurin (CaN), respectively, mediates PC2 ciliary localization in C. elegans.the N-glycosylation of five residues within the expansive TOP domain of PC2 (amino acids: Asn299, 305, 328, 362, and 375).In its multiple-ion (inhibited) state, Asn299, 328, 362 and 375 are N-glycosylated, and are important for maintaining well-ordered loop interactions. The N-glycosylation of Asn305 is predicted to prevent the intra-tetramer interactions that occur in the multiple-ion state, thus leaving the single-ion state less ordered.
Bibliography Brill AL, Ehrlich BE. Polycystin 2: A calcium channel, channel partner, and regulator of calcium homeostasis in ADPKD. Cell Signal. 2020 Feb;66:109490. doi: 10.1016/j.cellsig.2019.109490. Epub 2019 Dec 2. PMID: 31805375; PMCID: PMC6935422.