Search by BoMiProt ID - Bomi8127


Primary Information

BoMiProt ID Bomi8127
Protein Name Poly(U)-binding-splicing factor PUF60/60 kDa poly(U)-binding-splicing factor
Organism Bos taurus
Uniprot IdQ2HJG2
Milk FractionWhey
Ref Sequence Id NP_001039598.1
Aminoacid Length 530
Molecular Weight 57087
Fasta Sequence https://www.uniprot.org/uniprot/Q2HJG2.fasta
Gene Name PUF60
Gene Id 512824
Protein Existence Status reviewed

Secondary Information

Protein Function encodes a splicing factor that interacts directly with SF3B4 and plays a role in the recognition of the 3-prime splice site during splicing and recruitment of U2 snRNP and subsequently U5 snRNP to the intron for splicing.
Biochemical Properties The C-terminal domain of PUF60, the PUMP domain, is distantly related to the RNA-recognition motif domain, and is probably important in protein–protein interactions.PUF60 forms SDSresistant dimers with an apparent molecular weight of 130 kDa, explaining the aberrant mobility of this protein on SDS-polyacrylamide gels.
PTMs Acetylation on Lys, Phosphorylation on Thr and Ser, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus OX=9913 GN=PUF60 PE=2 SV=1 MATATIALGTDSIKMENGQGTAAKLGLPPLT*41PEQQEALQKAKKYAMEQSIKSVLVKQTIA HQQQQLTNLQMAAVTMGFGDPLS*83PLQSMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAF APFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIG QAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKS*215VFEAFGKIKSCTLARDPTTGKHKGY GFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPAT*285PGGLPPAAAVAAAAA TAKITAQEAVAGAAVLGTLATPGLVSPALTLAQPLGALPQAVMAAQAPGVITGVTPARPP IPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQEHMSISGSSARH MVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDA EIIVKIFVEFSVASETHKAIQDLNGRWFAGRKVVAEVYDQERFDNSDLSA
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography PAGE-McCAW, P., AMONLIRDVIMAN, K., & SHARP, P. (1999). PUF60: A novel U2AF65-related splicing activity. RNA, 5(12), 1548-1560. doi:10.1017/S1355838299991938