Search by BoMiProt ID - Bomi8123


Primary Information

BoMiProt ID Bomi8123
Protein Name Poly(ADP-ribose) glycohydrolase
Organism Bos taurus
Uniprot IdO02776
Milk FractionWhey
Ref Sequence Id NP_776563.1
Aminoacid Length 977
Molecular Weight 110837
Fasta Sequence https://www.uniprot.org/uniprot/O02776.fasta
Gene Name PARG
Gene Id 281377
Protein Existence Status reviewed

Secondary Information

Protein Function involved in DNA replication and repair.hydrolysing the ribose-ribose bonds present in poly(ADP-ribose).PARG depleted/inhibited cells show increased sensitivity to DNA damaging agents. PARG is thought to play an important role in preventing the accumulation of cytoplasmic PAR and therefore parthanatos, a caspase-independent PAR-mediated type of cell death.
Biochemical Properties both endo-glycohydrolase and exo-glycohydrolase activity, preferentially performing the latter by binding to the two most distal ADP-ribose residues within the PAR chain.These different modes of catalysis produce free PAR and mono ADP-ribose moieties, respectively. The free mono ADP-ribose is then metabolized into AMP and ribose 5′ phosphate by ADP-ribose pyrophosphohydrolases.
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O02776|PARG_BOVIN Poly(ADP-ribose) glycohydrolase OS=Bos taurus OX=9913 GN=PARG PE=1 SV=1 MSAGPGCEPCTKRPRWDAAATSPPAASDARSFPGRQRRVLDSKDAPVQFRVPPSSSGCAL GRAGQHRGS*69ATSLVFKQKTITSWMDTKGIKTVESESLHSKENNNTREESMMSSVQKDNFY QHNMEKLENVSQLGFDKS*138PVEKGTQYLKQHQTAAMCKWQNEGPHSERLLESEPPAVTLVP EQFSNANVDQSSPKDDHS*198DT*200NSEESRDNQQFLTHVKLANAKQTMEDEQGREARSHQKCGK ACHPAEACAGCQQEETDVVSES*262PLS*265DTGSEDVGTGLKNANRLNRQES*287SLGNS*292PPFEKES*299EPES*303PMDVDNSKNSCQDS*317EADEETSPGFDEQEDSSSAQTANKPSRFQPREADTELRKRSSAKGGEIRLHFQFEGGESRAGMNDVNAKRPGSTSSLNVECRNSKQHGRKDSKITDHFMRVPK AEDKRKEQCEMKHQRTERKIPKYIPPHLS*449PDKKWLGTPIEEMRRMPRCGIRLPPLRPSAN HTVTIRVDLLRIGEVPKPFPTHFKDLWDNKHVKMPCSEQNLYPVEDENGERAAGSRWELI QTALLNRLTRPQNLKDAILKYNVAYSKKWDFTALIDFWDKVLEEAEAQHLYQSILPDMVK IALCLPNICTQPIPLLKQKMNHSITMSQEQIASLLANAFFCTFPRRNAKMKSEYSSYPDI NFNRLFEGRSSRKPEKLKTLFCYFRRVTEKKPTGLVTFTRQSLEDFPEWERCEKLLTRLH VTYEGTIEGNGQGMLQVDFANRFVGGGVTSAGLVQEEIRFLINPELIVSRLFTEVLDHNE CLIITGTEQYSEYTGYAETYRWARSHEDRSERDDWQRRTTEIVAIDALHFRRYLDQFVPE KIRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAVAERDVVY FTFGDSELMRDIYSMHTFLTERKLTVGEVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHA VESCTQTTNQPGQRTGA
Predicted Disorder Regions (19-29), (170-360)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Harrision D, Gravells P, Thompson R, Bryant HE. Poly(ADP-Ribose) Glycohydrolase (PARG) vs. Poly(ADP-Ribose) Polymerase (PARP) - Function in Genome Maintenance and Relevance of Inhibitors for Anti-cancer Therapy. Front Mol Biosci. 2020 Aug 28;7:191. doi: 10.3389/fmolb.2020.00191. PMID: 33005627; PMCID: PMC7485115.