Search by BoMiProt ID - Bomi8084


Primary Information

BoMiProt ID Bomi8084
Protein Name Pleckstrin homology domain-containing family O member 2/PH domain-containing family Q member 1
Organism Bos taurus
Uniprot IdQ32LQ1
Milk FractionWhey
Ref Sequence Id NP_001069751.1
Aminoacid Length 499
Molecular Weight 54119
Fasta Sequence https://www.uniprot.org/uniprot/Q32LQ1.fasta
Gene Name PLEKHO2/PLEKHQ1
Protein Existence Status reviewed

Secondary Information

Biochemical Properties is a member of the PH-domain-containing protein.The PH domain consists of a ~100-amino acid region.PLEKHO2 deficiency facilitates necroptosis and activation of RIPK1.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32LQ1|PKHO2_BOVIN Pleckstrin homology domain-containing family O member 2 OS=Bos taurus OX=9913 GN=PLEKHO2 PE=2 SV=1 MEEEGVKEGGQRPRSAQTADKAGWIKKSSGGFLGLWKDRYLLLCQAQLLVYENEDEQKCV ETVELGSYEKCQDLRALLKRKHRFILLRSPGNKVSDIKFQAPSGEEKESWIKALNEGINR GKNKAFDEVKVDKSCVLEHVTRDRVRRDQRRRPPTRVHLKEVANAAS*167DGLSRLDLDVPDS GPPVLAPSNDVDAAQPRETPRPPMPPAKPSPAPETSSAGDRMETPVGQSAPAPVPAS*237S*238EA HPGSQEDLETPVVEDSDSEQPPNRILPDKLKVS*273WENPSPEEAPDSESAEPPQVPGAET*298SE AGPREGGKPPT*311PPPKILSEKLKASMSGMEASGPAQSPGASEASAPGPAEVSVNGVDDSPE PLQSSQAAGPPGTPPKAATTSTTLPPWDLQPQLHPRCSS*399LGDLLGEGPRRRRQPGEQLHR AQLEVKVASEKTEKLLNKVLGGESASVNAETLLSQAVEQLRQATQVLQEIRDLEEMNREA PGLREKRRELVTLYRRSVP
Predicted Disorder Regions (1-23), (140-426), (449-475)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Zhou, C., Zhang, X., Yang, C. et al. PLEKHO2 inhibits TNFα-induced cell death by suppressing RIPK1 activation. Cell Death Dis 12, 714 (2021). https://doi.org/10.1038/s41419-021-04001-2 2.Harhay, G. P., Sonstegard, T. S., Keele, J. W., Heaton, M. P., Clawson, M. L., Snelling, W. M., Wiedmann, R. T., Van Tassell, C. P., & Smith, T. P. (2005). Characterization of 954 bovine full-CDS cDNA sequences. BMC genomics, 6, 166. https://doi.org/10.1186/1471-2164-6-166