Search by BoMiProt ID - Bomi8035


Primary Information

BoMiProt ID Bomi8035
Protein Name Pinin
Organism Bos taurus
Uniprot IdP79122
Milk FractionWhey
Aminoacid Length 703
Molecular Weight 79491
Fasta Sequence https://www.uniprot.org/uniprot/P79122.fasta
Gene Name PNN
Protein Existence Status reviewed

Secondary Information

Protein Function to pin intermediate filaments to the desmosome.participate the intermediate filament-desmosome complex formation.
Biochemical Properties contain heptad repeats which forms coiled-coil rod domains. Two glycine loop sequence segments are found on the C terminal of the heptad repeat region.Glycine loops are expected to be highly flexible, and may participate in interactions with neighboring glycine loops on the same or adjacent proteins.
PTMs Acetylation, Isopeptide bond, Methylation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P79122|PININ_BOVIN Pinin OS=Bos taurus OX=9913 GN=PNN PE=2 SV=3 MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALS*48GPGGGRGRGS*58LL LRRGFS*66DSGGGPPAKQRDLEGAVSRLGGERRTRRES*96RQES*100DPEDDDVKKPALQS*114S*115VVATSKERS*125TERPLFQDQNTDEKETPERPGPIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLE VQAEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTK PHLFYIPGRMCPAPKLIEESQRKTNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVV RNEEQKSEQEEGKVAPRTRVMLRALDDLVARVGTPSPRRGSGEEEEKEIPIVHS*354DAEKEQ EEEEQKQEMEVKMEEETEVRES*382EKQQDS*388QPEEVMDVLEMVESVKNVIAEQEVMETNQVER VEPSENEASKELEPEMEFEIEPDKECKSLS*450PGKENAS*457TLEMENEPEEKEEKESEPQPEPM AQPQAQSLPQPQPQRHRQSQSQPQQYSSPPPLSQPETLPLAVSQPPPQLIQRQGHLPPER KEFLVESVKLTEVPTEPVLTVHSES*565KYETKTRSRSRGRARNRTSKSRSRSSSSSSSSSSS TSSSSGSSSSSGSSSSRTSSSSSSTSGSSSRDSSSSTTSSSESRSRSRGRGHNRDRKHRR SVDRKRRDAS*670GLERSHKSAKGGSSRDAKAVS*691SSGMPRFKPGQL
Predicted Disorder Regions 50-55, 75-134, 333-533, 567-699
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs . Residues 635-700 comprise a serine-rich domain. Serines comprise 48 of the 65 residues. The polyserine domain may be highly flexible and may represent a "hot spot" for the phosphorylation of pinin.contains motifs recognized by Ca+2/calmodulin protein kinases (RXXS), c-AMP--dependent kinases (XRRXSX), c-GMP--dependent protein kinase (XSRX), protein kinase C (XRXXSX), and casein kinase 2(XSXXEX).Serine on these sites are highly phosphorylated
Bibliography Ouyang P, Sugrue SP. Characterization of pinin, a novel protein associated with the desmosome-intermediate filament complex. J Cell Biol. 1996 Nov;135(4):1027-42. doi: 10.1083/jcb.135.4.1027. PMID: 8922384; PMCID: PMC2133386.