Search by BoMiProt ID - Bomi8028


Primary Information

BoMiProt ID Bomi8028
Protein Name Phytanoyl-CoA dioxygenase domain-containing protein 1
Organism Bos taurus
Uniprot IdQ0IIB1
Milk FractionExosomes
Ref Sequence Id NP_001069711.1
Aminoacid Length 291
Molecular Weight 32539
Fasta Sequence https://www.uniprot.org/uniprot/Q0IIB1
Gene Name PHYHD1
Gene Id 540828
Protein Existence Status Reviewed

Secondary Information

Protein Function PHYHD1 might play a role in the hydroxylation of fatty acids and interact with some fatty acids or derivatives thereof.
PTMs Phosphorylation at Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0IIB1|PHYD1_BOVIN Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Bos taurus OX=9913 GN=PHYHD1 PE=2 SV=1 MACLSPSQLQKFQEDGFLVLEGFLSADECEAMQRRIDEIVAKMDVPLHCRTEFST*55QEEEQ LRAQGSTDYFLSSGDKIRFFFEKGVFDKQGNFLVPPEKSINKIGHALHALDPIFRCVTHS HKVQALARSLGLQMPVVVQSMYIFKQPHFGGEVAPHQDASFLYTEPLGRVLGLWIALEDA MLENGCLWFIPGSHTGGVSRRMVRTPAGSVPGTSFLGSEPIRDNSLFVPTPVLRGALVLI HGEVVHKSEQNLSDRSRQAYTFHLMEAAGTIWSPDNWLQPTPELPFPPLYT
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Silencing of PHYHD1 leads to the downregulation of many chorion protein genes, thus directly causing giant eggs.Mutation of PHYHD1 may cause abnormal production and secretion of vitellogenin, resulting in abnormal production and secretion of yolk proteins.
Bibliography 1.Chen A, Liao P, Li Q, Zhao Q, Gao M, Wang P, Liu Z, Meng G, Dong Z, Liu M. phytanoyl-CoA dioxygenase domain-containing protein 1 plays an important role in egg shell formation of silkworm (Bombyx mori). PLoS One. 2021 Dec 30;16(12):e0261918. doi: 10.1371/journal.pone.0261918. PMID: 34968397; PMCID: PMC8717975. 2.Zhang Z, Kochan GT, Ng SS, Kavanagh KL, Oppermann U, Schofield CJ, et al.. Crystal structure of PHYHD1A, a 2OG oxygenase related to phytanoyl-CoA hydroxylase. Biochem Biophys Res Commun. 2011, 408(4): 553–558. doi: 10.1016/j.bbrc.2011.04.059