Search by BoMiProt ID - Bomi8020


Primary Information

BoMiProt ID Bomi8020
Protein Name Phosphoribosyl pyrophosphate synthase-associated protein 2
Organism Bos taurus
Uniprot IdA2VDS0
Milk FractionExosomes
Ref Sequence Id NP_001074982.1
Aminoacid Length 369
Molecular Weight 40714
Fasta Sequence https://www.uniprot.org/uniprot/A2VDS0.fasta
Gene Name PRPSAP2
Gene Id 506111
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells retropharyngeal lymph node and other tissues
Protein Function Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis.
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VDS0|KPRB_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Bos taurus OX=9913 GN=PRPSAP2 PE=2 SV=1 MFCVAPPESEAKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPDRETR VQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVVPYFPYSKQCKMR KRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDY RNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAES*219DLVDGRHS*227PPMVRS*233AAAIHPS LEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHG LLSSDAPLLIEESAIDEVVVTNTIPHEIQKLQCPKIKTVDISMTLSEAIRRIHNGESMSY LFRNIGLDD
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices