Search by BoMiProt ID - Bomi8


Primary Information

BoMiProt ID Bomi8
Protein Name Plasminogen
Organism Bos taurus
Uniprot IdP06868
Milk FractionWhey
Ref Sequence Id NP_776376.1
Amino Acid Lenth 812
Molecular Weight 91216
Fasta Sequence https://www.uniprot.org/uniprot/P06868.fasta
Gene Name PLG
Gene Id 280897
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondry Information

Presence in other biological fluids/tissue/cells blood, milk
Protein Function Active form is plasmin; primary physiological role in blood is to dissolve blood clots; In bovine milk, plasmin is present mostly as plasminogen, and the plasmin system is controlled by activators and inhibitors;
Biochemical Properties Plasmin catalyzes cleavages of Lys↓Xaa and Arg↓X bonds, with a specificity similar to that of trypsin; much less efficient enzyme than trypsin; esters and amides of arginine and lysine are cleaved with relative rates affected by the inherent susceptibility of the leaving group to hydrolysis; Most inhibitors of trypsin also inhibit plasmin
Significance in milk associated with casein micelIes in milk and degrades B-, cr,t- and a,z-caseins to y-caseins, proteose-peptones and possibly I-casein.
PTMs N-glycosylated; asparagine residue in position 289
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P06868|PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
MLPASPKMEHKAVVFLLLLFLKSGLGDLLDDYVNTQGASLLSLSRKNLAG RSVEDCAAKCEEETDFVCRAFQYHSKEQQCVVMAENSKNTPVFRMRDVIL YEKRIYLLECKTGNGQTYRGTTAETKSGVTCQKWSATSPHVPKFSPEKFP LAGLEENYCRNPDNDENGPWCYTTDPDKRYDYCDIPECEDKCMHCSGENY EGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNLKMNYCRNPDGEPRP WCFTTDPQKRWEFCDIPRCTTPPPSSGPKYQCLKGTGKNYGGTVAVTESG HTCQRWSEQTPHKHN*315RTPENFPCKNLEENYCRNPNGEKAPWCYTTNSEVR WEYCTIPSCESSPLS*365TERMDVPVPPEQTPVPQDCYHGNGQSYRGTSSTTI TGRKCQSWSSMTPHRHLKTPENYPNAGLTMNYCRNPDADKSPWCYTTDPR VRWEFCNLKKCSETPEQVPAAPQAPGVENPPEADCMIGTGKSYRGKKATT VAGVPCQEWAAQEPHQHSIFTPETNPQSGLERNYCRNPDGDVNGPWCYTM NPRKPFDYCDVPQCESSFDCGKPKVEPKKCSGRIVGGCVSKPHSWPWQVS LRRSSRHFCGGTLISPKWVLTAAHCLDNILALSFYKVILGAHNEKVREQS VQEIPVSRLFREPSQADIALLKLSRPAIITKEVIPACLPPPNYMVAARTE CYITGWGETQGTFGEGLLKEAHLPVIENKVCNRNEYLDGRVKPTELCAGH LIGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSP YVPWIEETMRRN
Additional Comments Deficiency in plasmin may lead to thrombosis; presence of plasmin may increase the risk of proliferative vitreoretinopathy
Bibliography 1. Kaminogawa, S., & Yamauchi, K. (1972). Decomposition of β-casein by milk protease similarity of the decomposed products to temperature-sensitive and r-caseins. Agricultural and Biological Chemistry, 36(2), 255–260. https://doi.org/10.1080/00021369.1972.10860238.
2. Precetti, A. S., Oria, M. P., & Nielsen, S. S. (1997). Presence in bovine milk of two protease inhibitors of the plasmin system. Journal of Dairy Science, 80(8), 1490–1496. https://doi.org/10.3168/jds.S0022-0302(97)76077-6.
3. Reimerdes, E. H., & Herlitz, E. (1979). The formation of gamma-caseins during cooling of raw milk. The Journal of Dairy Research, 46(2), 219–221. https://doi.org/10.1017/s0022029900017076