Search by BoMiProt ID - Bomi7962


Primary Information

BoMiProt ID Bomi7962
Protein Name Phosphatidylinositol-glycan-specific phospholipase D/Glycoprotein phospholipase D/Glycosyl-phosphatidylinositol-specific phospholipase D
Organism Bos taurus
Uniprot IdP80109
Milk FractionWhey,MFGM
Ref Sequence Id NP_777241.1
Aminoacid Length 839
Molecular Weight 92602
Fasta Sequence https://www.uniprot.org/uniprot/P80109.fasta
Gene Name GPLD1/PIGPLD
Gene Id 287025
Protein Existence Status reviewed

Secondary Information

Protein Function  hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans (GPI-anchor) thus releasing these proteins from the membrane.
Biochemical Properties C terminal is important for activity.Tyr-811 may play a major role in maintaining the biological activity of GPI-PLD.insulin activates GPLD1 and induces GPI hydrolysis
PTMs Glycosylated
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P80109|PHLD_BOVIN Phosphatidylinositol-glycan-specific phospholipase D OS=Bos taurus OX=9913 GN=GPLD1 PE=1 SV=1 MSAFRFWSGLLMLLGFLCPRSSPCGISTHIEIGHRALEFLHLQDGSINYKELLLRHQDAY QAGSVFPDSFYPSICERGQFHDVSESTHWTPFLN*94ASVHYIRKNYPLPWDEDTEKLVAFLF GITSHMVADVNWHSLGIEQGFLRTMAAIDFHNSYPEAHPAGDFGGDVLSQFEFKFNYLSR HWYVPAEDLLGIYRELYGRIVITKKAIVDCSYLQFLEMYAEMLAISKLYPTYSVKSPFLV EQFQEYFLGGLEDMAFWSTNIYHLTSYMLKN*271GTSNCNLPENPLFITCGGQQN*292NTHGSKVQ KNGFHKN*307VTAALTKNIGKHIN*321YTKRGVFFSVDSWTMDSLSFMYKSLERSIREMFIGSSQP LTHVSSPAASYYLSFPYTRLGWAMTSADLNQDGYGDLVVGAPGYSHPGRIHVGRVYLIYG NDLGLPRIDLDLDKEAHGILEGFQPSGRFGSAVAVLDFNVDGVPDLAVGAPSVGSEKLTY TGAVYVYFGSKQGQLSSSPN*500VTISCQDTYCNLGWTLLAADVNGDSEPDLVIGSPFAPGGG KQKGIVAAFYSGSSYSSREKLNVEAANWMVKGEEDFAWLGYSLHGVNVNN*590RTLLLAGSPT WKDTSSQGHLFRTRDEKQSPGRVYGYFPPICQSWFTISGDKAMGKLGTSLSSGHVMVN*658GT RTQVLLVGAPTQDVVSKVSFLTMTLHQGGSTRMYELTPDSQPSLLSTFSGNRRFSRFGGV LHLSDLDNDGLDEIIVAAPLRITDATAGLMGEEDGRVYVFNGKQITVGDVTGKCKSWVTP CPEEKAQYVLISPEAGSRFGSSVITVRSKEKNQVIIAAGRSSLGARLSGVLHIYRLGQD
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs glycosylation is important for interaction with other factors.
Bibliography Stadelmann B, Bütikofer P, König A, Brodbeck U. The C-terminus of glycosylphosphatidylinositol-specific phospholipase D is essential for biological activity. Biochim Biophys Acta. 1997 Feb 4;1355(2):107-13. doi: 10.1016/s0167-4889(96)00119-x. PMID: 9042330.