Search by BoMiProt ID - Bomi7945


Primary Information

BoMiProt ID Bomi7945
Protein Name Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma/Phosphatidylinositol 5-phosphate 4-kinase type II gamma/PI(5)P 4-kinase type II gamma/PIP4KII-gamma
Organism Bos taurus
Uniprot IdQ0P5F7
Milk Fractionwhey
Ref Sequence Id NP_001069664.1
Aminoacid Length 421
Molecular Weight 47142
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5F7.fasta
Gene Name PIP4K2C/PIP5K2C
Gene Id 540005
Protein Existence Status Reviewed

Secondary Information

Protein Function It behaves as phosphatidylinositol 5-phosphate 4-kinase but shows significantly lower enzymatic activity. It may be a GTP sensor as it has higher GTP-dependent kinase activity than ATP-dependent kinase activity.
Biochemical Properties Interacts with PIP5K1A; the interaction inhibits PIP5K1A kinase activity
PTMs Acetylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5F7|PI42C_BOVIN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Bos taurus OX=9913 GN=PIP4K2C PE=2 SV=1 MASSSVPPTAVPAATAAPGAGFGFAS*26KTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSIN ELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQ DYLVSLTRSPPTESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT LLPQFLGMYRVSVDSEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL KDMDFLNKNQKVYIGEEEKKVFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEDG PVREEESEGDGDCGLTGPPAPVGSYGTSPEGIGGYIHSHRPLGPGEFES*349FIDVYAIRSAE GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF A
Predicted Disorder Regions 1-38, 129-137, 294-337, 389-394
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs phosphorylation is induced by EGF
Bibliography Lima, K., Coelho-Silva, J. L., Kinker, G. S., Pereira-Martins, D. A., Traina, F., Fernandes, P., Markus, R. P., Lucena-Araujo, A. R., & Machado-Neto, J. A. (2019). PIP4K2A and PIP4K2C transcript levels are associated with cytogenetic risk and survival outcomes in acute myeloid leukemia. Cancer genetics, 233-234, 56–66. https://doi.org/10.1016/j.cancergen.2019.04.002