Primary Information |
---|
BoMiProt ID | Bomi7926 |
---|
Protein Name | Phosducin-like protein 3 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q0VCW8 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence Id | NP_001069113.1 |
---|
Aminoacid Length | 240 |
---|
Molecular Weight | 27479 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q0VCW8.fasta |
---|
Gene Name | PDCL3 |
---|
Gene Id | 514033 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Protein Function | Phosducin-like protein 3 (PhLP3) forms a ternary complex with the ATP-dependent molecular chaperone CCT and its folding client tubulin.PhLP3 plays an inhibitory role in β-tubulin folding while conversely in vivo genetic studies suggest PhLP3 is required for the correct folding of β-tubulin. |
---|
PTMs | N-acetylation at Meth,Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VCW8|PDCL3_BOVIN Phosducin-like protein 3 OS=Bos taurus OX=9913 GN=PDCL3 PE=2 SV=1
MQDPNADTEWNDILRKKGILPSKEDLKDLEKEAEEEEQRILQQS*44IVKTYEDMTLEELEDN
EDEFNEEDERAIEMYRQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHL
YKQGIPLCALINQHLSALARKFPDVKFIKAISTTCIPSYPDRNLPTVFVYLEGDIKAQFI
GPLVFGGMNLTLDELEWKLSESGAIKTSLEENPKKPVEDVLLSAVRCSVPAKRDS*235DS*237EDD
|
---|
Predicted Disorder Regions | 1-70, 208-240 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | N-terminal methionine acetylation destabilizes the protein. |
---|
Additional Comments | Overexpression of PhLP3 has dramatic effects upon microtubule networks, disassembling the interphase microtubule array, mislocalising β-tubulin to nuclei |
---|
Bibliography | 1.Hayes NV, Jossé L, Smales CM, Carden MJ. Modulation of phosducin-like protein 3 (PhLP3) levels promotes cytoskeletal remodelling in a MAPK and RhoA-dependent manner. PLoS One. 2011;6(12):e28271. doi: 10.1371/journal.pone.0028271. Epub 2011 Dec 9. PMID: 22174782; PMCID: PMC3235111. 2. |