Search by BoMiProt ID - Bomi7926


Primary Information

BoMiProt ID Bomi7926
Protein Name Phosducin-like protein 3
Organism Bos taurus
Uniprot IdQ0VCW8
Milk FractionExosomes
Ref Sequence Id NP_001069113.1
Aminoacid Length 240
Molecular Weight 27479
Fasta Sequence https://www.uniprot.org/uniprot/Q0VCW8.fasta
Gene Name PDCL3
Gene Id 514033
Protein Existence Status Reviewed

Secondary Information

Protein Function Phosducin-like protein 3 (PhLP3) forms a ternary complex with the ATP-dependent molecular chaperone CCT and its folding client tubulin.PhLP3 plays an inhibitory role in β-tubulin folding while conversely in vivo genetic studies suggest PhLP3 is required for the correct folding of β-tubulin.
PTMs N-acetylation at Meth,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VCW8|PDCL3_BOVIN Phosducin-like protein 3 OS=Bos taurus OX=9913 GN=PDCL3 PE=2 SV=1 MQDPNADTEWNDILRKKGILPSKEDLKDLEKEAEEEEQRILQQS*44IVKTYEDMTLEELEDN EDEFNEEDERAIEMYRQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHL YKQGIPLCALINQHLSALARKFPDVKFIKAISTTCIPSYPDRNLPTVFVYLEGDIKAQFI GPLVFGGMNLTLDELEWKLSESGAIKTSLEENPKKPVEDVLLSAVRCSVPAKRDS*235DS*237EDD
Predicted Disorder Regions 1-70, 208-240
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs N-terminal methionine acetylation destabilizes the protein.
Additional Comments Overexpression of PhLP3 has dramatic effects upon microtubule networks, disassembling the interphase microtubule array, mislocalising β-tubulin to nuclei 
Bibliography 1.Hayes NV, Jossé L, Smales CM, Carden MJ. Modulation of phosducin-like protein 3 (PhLP3) levels promotes cytoskeletal remodelling in a MAPK and RhoA-dependent manner. PLoS One. 2011;6(12):e28271. doi: 10.1371/journal.pone.0028271. Epub 2011 Dec 9. PMID: 22174782; PMCID: PMC3235111. 2.